10,000 Matching Annotations
  1. Mar 2026
    1. Reviewer #1 (Public review):

      Summary:

      They use cultures of insulinoma MIN6 cells that form spheroids in a micro-patterned PEG-hydrogel to measure Ca2+ oscillations in multiple cells simultaneously.

      Strengths:

      They demonstrate that insulinoma spheroids are formed in multi-well plates and that Ca2+ imaging can be performed on them.

      Weaknesses:

      The type of equipment and multi-wells used for the experiments are very specialized to be used as a common tool. Insulinoma cells are tumoral cell lines that divide, unlike primary beta cells. Pancreatic islets are very different from this preparation, as they are highly heterogeneous, whereas these cells all respond equally. It would be good to see the same technique applied to primary cells.

      MIN6 cells do not respond to glucose and other secretagogues in the same way as primary cells, and they cycle, depending on the phase of the cycle to which they are exposed.

      The authors should report the number of cells per spheroid and the number of cells that are alive and dead.

      I would like to examine the effects of calcium channel blockers on calcium transients, and the use of pregnenolone is already described in the literature, but remains less well known.

      MIN6 cells secrete much insulin, because detecting the hormone in ELISAs requires too many primary cells. The authors should discuss the model in greater detail and compare it with primary beta cells. Also, they take 3 mM glucose as the basal concentration, which is low.

    2. Reviewer #2 (Public review):

      Summary:

      The study by Robben et al., show 3D beta-cell spheroid platform, a valuable tool allowing high-throughput monitoring of cytoplasmic Ca concentrations and insulin secretion, with Ca signals comparable to those recorded in primary islets. The authors demonstrate a solid method to culturing MIN6 cells in a 3D culture system, recording Ca signals in a high-throughput format and characterizing these Ca signals using pharmacological tools, including TRPM3 channel and K-ATP channel modulators. This highlights the utility of the 3D beta-cell spheroid for screening new ion channel modulators in beta-cells of the pancreas.

      Strengths:

      - The study shows that the MIN-6-based 3D beta-cell model is better to study Ca-signaling and insulin secretion compared to 2D culture of single MIN-6 cells.

      - The method allows imaging of Ca signaling in many spheroids in parallel followed by collecting medium to measure insulin release and correlate both effects.

      - The authors demonstrate that this system is suitable for screening new pharmacological modulators and used as an agonist of the ATP-sensitive potassium channel (diazoxide) and the agonist and antagonist of the TRPM3 channel.

      Weaknesses:

      - The study is based on only one cell line, the MIN6 insulinoma cells, which may not fully mimic the pancreatic beta-cells within the islet.

      - The authors show only spheroids cultured overnight. A long-term culture is missing to assess beta-cell viability long term function.

      - The authors tested their platform using only two compounds. Testing a larger compound library is necessary to make a clear conclusion about the suitability of the platform for high-throughput screening.

    3. Reviewer #3 (Public review):

      Summary:

      The primary objective of this study is to develop high-throughput screening assays utilizing homogeneous 3D cell cultures that more accurately replicate the intricate architecture and cellular communication found in tissues. The authors have chosen pancreatic islet β-cells as a model system to evaluate agents that modulate insulin release, which is particularly relevant given the increasing prevalence of diabetes mellitus-a significant global health concern. Moreover, the incorporation of human-based 3D spheroids, organoids, or organ-on-chip technologies into drug discovery protocols is essential for enhancing clinical translation, as candidate compounds identified using animal models have often demonstrated limited success in clinical settings.

      Strengths:

      This study was thoughtfully planned and skillfully carried out. The use of micropatterned hydrogels to observe 19 spheroids at once is an ingenious aspect, which has been effectively validated with Ca microfluorography. Overall, I found this investigation to be exceptionally well-executed and free from notable flaws, as the results clearly back up the conclusions. Additionally, the developed method achieved the proposed aims, providing a high-throughput format with 3D cultures. I believe this study deserves publication.

      Weaknesses:

      For an HTS assay, authors should incorporate the Z-factor.

    1. eLife Assessment

      This study presents valuable findings that could potentially allow a deeper understanding of the immunopathogenesis underlying influenza infection in aged mice. The results are based on solid evidence that define putative immune determinants underlying immunopathology in the aged lung. This study will be of interest to researchers pursuing aging research, as well as to immunologists.

    2. Reviewer #1 (Public review):

      Summary:

      In this report, Dr Jie Sun and colleagues employed high-resolution single-cell technologies (transcriptomic + cytometry) to build a temporal map of lung responses after IAV infection in young and old mice. They performed detailed analyses of several innate and adaptive immune compartments and described how age influences each of them. The data are robustly generated, and the analyses provide interesting observations that could be associated with disease severity in aged mice. Mechanistically, the authors provide evidence that IFNa/g signaling after viral clearance could mediate some long-term respiratory outcomes, possibly by acting on MoIMs.

      Strengths:

      (1) Comprehensive temporal profiling of lung responses.

      (2) Combination of scRNA_seq and flow cytometry.

      (3) Mechanistic part assessing the role of IFNa/g signaling.

      Weaknesses:

      (1) Descriptive nature of the study.

      (2) Lack of quantification of lung lesions.

      (3) Lung functional measurements were only assessed in aged mice (with or without treatment).

      (4) No assessment of global and virus-specific humoral responses, which could be related to changes in B cells.

      (5) Recently described "pro-repair" Ly6G+ macrophages after IAV infection (PMID: 39093958) are not considered here, and the gating strategy encompasses them in the neutrophil gate.

      (6) The authors suggest that IMs in the aged lung may serve as a major contributor to the pathogenesis of long-term sequelae observed in aged hosts, but do not assess this possibility experimentally.

      Addressing the weaknesses identified above would substantially strengthen the conclusions of the manuscript.

    3. Reviewer #2 (Public review):

      Summary:

      In this paper, the authors leverage single-cell approaches to delve deeper into the host responses and immune cells involved in immunopathogenesis of influenza virus infection in aged mice. The dynamics of gene expression and immune cell frequencies were also tracked at multiple time-points to examine the acute and chronic changes in young and aged mice after influenza virus infection. Their analyses demonstrated that the immune cell frequencies and gene signatures differed in young and aged mice, especially macrophages, T cells and B cells. Furthermore, interferon pathways were found to be differentially regulated in the young and aged mice, and blocking the interferon pathway with monoclonal antibodies led to improvement in lung respiratory functions and reduced inflammation.

      Strengths:

      A strength of this study is that multiple time points are considered for analyses, allowing assessment of temporal changes in gene expression and immune cell frequencies after virus infection during the acute and chronic phases of the disease. The data presented could also serve as a potential resource for other researchers interested in understanding the host responses to the influenza virus, especially in aged mice. Another interesting finding was that blocking interferon signalling can reduce the chronic severe symptoms caused by the influenza virus in aged mice.

      Weaknesses:

      The manuscript could greatly benefit from more rigorous approaches, particularly in the statistical analyses and data visualisation. Moreover, the scientific rationale and logic for several parts of the manuscript can be improved. Finally, the authors did not adequately dissect whether the contribution of host responses was from virus infection or from bystander effects. Specifically, my major comments are as follows:

      (1) While it is interesting to compare the difference in host responses between aged and young mice, the authors should also more deeply characterise the differences in phenotypic and infection kinetics between aged and young mice, so that the readers can better appreciate the effects of virus infection and host immune tolerance to viral infection. For instance, what are the differences in virus infection kinetics between the aged and young mice? Are the levels of infection different? Are the virus dynamics and kinetics different between aged and young mice? Besides lung tissue damage, are there also tissue damage or inflammatory responses beyond lung tissues that differ between aged and young mice?

      (2) Figure 1B: Could the authors quantify the extent of tissue damage in aged and young adults? It is challenging to interpret the extent of tissue damage, especially across the different time points.

      (3) Figure 1D: The authors claim that the senescence signatures are higher in aged mice, justifying that the pathway analyses are consistent with ageing signatures. However, it is also important to note that the senescence signatures were insignificant in aged mice after day 14. Is this expected?

      (4) Figure 1E: The stacked bar charts are difficult to read. It is unclear if the cell type frequencies or proportions are significantly changed, especially as the authors are showing these changes with averaged values. Moreover, the authors should keep the colours of the bar charts consistent with the UMAP.

      (5) Figure 1F-M: The charts show increased frequencies of innate and adaptive immune cells in aged mice. How about the young mice? Which type of cells are increased to allow these mice to be more tolerant to infection?

      (6) Figure 2D and Figure S2C: Besides showing the dynamics of the different clusters, the authors should also display the statistics for individual mice. If the analyses have to be pooled for the single-cell analysis, the authors should declare the challenges and show the statistical comparisons for the flow cytometry.

      (7) Figure 3E: The authors should not claim differences in somatic hypermutation based on gene expression. This will require BCR sequencing and evidence for clonal expansion to confirm that there are differences in somatic hypermutation. Moreover, the authors did not measure the quality and quantity of antibody responses between aged and young mice. The claims for the antibody responses are thus extrapolated, and the B cell identities cannot be identified without any functional or phenotypic readouts.

      (8) Figure 4H. Why did the authors not perform the experiments for aged mice with a higher virus dose? Also, the spider plots do not display the variability between individual mice, making it challenging to interpret whether the changes were statistically different between the conditions.

      (9) Figure 5A. Is the interferon pathway the only pathway that was significantly enriched in the aged mice? Is it the top pathway? The authors should also show the other pathways that were significantly enriched in aged mice. Did the authors also analyse whether the differences in interferon pathways were caused by infected cells or by bystander cells?

      (10) Figure 5B: Based on the pathway analyses, the peak responses for interferon are at day 9 post-infection. However, the interferon treatment is performed on day 14, where differences were less apparent. Why did the authors choose to do the interferon treatment at day 14 instead?

      (11) Figure 6: How about interferon-mediated cell-cell interactions? The authors should consider using established libraries such as Cell Chat to determine if there are any cell-cell communications that lead to differences in interferon responses and signaling.

      (12) Throughout the whole manuscript, the authors kept emphasising that the aged mice displayed uncoordinated immune responses, yet, based on the pathway analyses and phenotypic characterisation, it appears that only interferon was mainly dysregulated. I would thus like to recommend that the authors adjust the tone of the manuscript to tailor it to the results obtained from their investigations.

    1. eLife Assessment

      This important study investigates how structurally diverse cardenolide toxins in tropical milkweed, especially mixtures containing nitrogen- and sulfur-containing variants, influence monarch caterpillar feeding, growth, and toxin sequestration. The experiments provide solid evidence that chemical diversity within a single group of plant toxins can have combined effects on even highly specialized herbivores that differ from the effects of each toxin alone. However, as the mixture design does not fully separate true diversity effects from the influence of the N,S-cardenolides themselves and the ecological basis for the chosen natural ratios remains weakly justified. As a result, the broader conclusions would require more fully justified concentration regimes, mixture treatments that exclude N,S-cardenolides, and tests on living plants and non-adapted herbivores to firmly support the proposed coevolutionary interpretation.

    2. Reviewer #1 (Public review):

      Summary:

      In the ecological interactions between wild plants and specialized herbivorous insects, structural innovation-based diversification of secondary metabolites often occurs. In this study, Agrawal et al. utilized two milkweed species (Asclepias curassavica and Asclepias incarnata) and the specialist Monarch butterfly (Danaus plexippus) as a model system to investigate the effects of two N,S-cardenolides-formed through structural diversification and innovation in A. curassavica-on the growth, feeding, and chemical sequestration of D. plexippus, compared to other conventional cardenolides. Additionally, the study examined how cardenolide diversification resulting from the formation of N,S-cardenolides influences the growth and sequestration of D. plexippus. On this basis, the research elucidates the ecophysiological impact of toxin diversity in wild plants on the detoxification and transport mechanisms of highly adapted herbivores.

      Strengths:

      The study is characterized by the use of milkweed plants and the specialist Monarch butterfly, which represent a well-established model in chemical ecology research. On one hand, these two organisms have undergone extensive co-evolutionary interactions; on the other hand, the butterfly has developed a remarkable capacity for toxin sequestration. The authors, building upon their substantial prior research in this field and earlier observations of structural evolutionary innovation in cardenolides in A. curassavica, proposed two novel ecological hypotheses. While experimentally validating these hypotheses, they introduced the intriguing concept of a "non-additive diversity effect" of trace plant secondary metabolites when mixed-contrasting with traditional synergistic perspectives-in their impact on herbivores.

      Weaknesses:

      The manuscript has two main weaknesses. First, as a study reliant on the control of compound concentrations, the authors did not provide sufficient or persuasive justification for their selection of the natural proportions (and concentrations) of cardenolides. The ratios of these compounds likely vary significantly across different environmental conditions, developmental stages, pre- and post-herbivory, and different plant tissues. The ecological relevance of the "natural proportions" emphasized by the authors remains questionable. Furthermore, the same compound may even exert different effects on herbivorous insects at different concentrations. The authors should address this issue in detail within the Introduction, Methods, or Discussion sections.

      Second, the study was conducted using leaf discs in an in vitro setting, which may not accurately reflect the responses of Monarch butterflies on living plants. This limitation undermines the foundation for the novel ecological theory proposed by the authors. If the observed phenomena could be validated using specifically engineered plant lines-such as those created through gene editing, knockdown, or overexpression of key enzymes involved in the synthesis of specific N,S-cardenolides-the findings would be substantially more compelling.

    3. Reviewer #2 (Public review):

      I have reviewed both the original and revised version of this manuscript and while no additional experiments were added, I find the interpretations and discussion of the limitations of the study have improved. This is appreciated.

      My original concern regarding the mixture treatments largely remains. Figure 4 nicely shows that the mixtures are more potent than the average of all single compounds. However, Fig S3 shows that the effects of mixtures are not significantly different from effects of at least one, single N,S compound (voruscharin or uscharin) across all measured growth/sequestration responses. Essentially, the effects of single N,S compounds is similar to mixtures (which also contain N,S compounds).

      While the current results are certainly interesting as presented, in my view the main takeaway of the manuscript would be more compelling if it could be demonstrated that it isn't simply the presence of N,S compounds in the mixtures driving the observations. For example, does a mixture of all compounds except voruscharin or uscharin still have stronger growth/sequestration effects compared to single non-N,S compounds?

    4. Author response:

      The following is the authors’ response to the original reviews.

      Public Reviews:

      Reviewer #1 (Public review):

      Summary:

      In the ecological interactions between wild plants and specialized herbivorous insects, structural innovation-based diversification of secondary metabolites often occurs. In this study, Agrawal et al. utilized two milkweed species (Asclepias curassavica and Asclepias incarnata) and the specialist Monarch butterfly (Danaus plexippus) as a model system to investigate the effects of two N,S-cardenolides - formed through structural diversification and innovation in A. curassavica-on the growth, feeding, and chemical sequestration of D. plexippus, compared to other conventional cardenolides. Additionally, the study examined how cardenolide diversification resulting from the formation of N,S-cardenolides influences the growth and sequestration of D. plexippus. On this basis, the research elucidates the ecophysiological impact of toxin diversity in wild plants on the detoxification and transport mechanisms of highly adapted herbivores.

      Strengths:

      The study is characterized by the use of milkweed plants and the specialist Monarch butterfly, which represent a well-established model in chemical ecology research. On one hand, these two organisms have undergone extensive co-evolutionary interactions; on the other hand, the butterfly has developed a remarkable capacity for toxin sequestration. The authors, building upon their substantial prior research in this field and earlier observations of structural evolutionary innovation in cardenolides in A. curassavica, proposed two novel ecological hypotheses. While experimentally validating these hypotheses, they introduced the intriguing concept of a "non-additive diversity effect" of trace plant secondary metabolites when mixed, contrasting with traditional synergistic perspectives, in their impact on herbivores.

      Weaknesses:

      The manuscript has two main weaknesses. First, as a study reliant on the control of compound concentrations, the authors did not provide sufficient or persuasive justification for their selection of the natural proportions (and concentrations) of cardenolides. The ratios of these compounds likely vary significantly across different environmental conditions, developmental stages, pre- and post-herbivory, and different plant tissues. The ecological relevance of the "natural proportions" emphasized by the authors remains questionable. Furthermore, the same compound may even exert different effects on herbivorous insects at different concentrations. The authors should address this issue in detail within the Introduction, Methods, or Discussion sections.

      Second, the study was conducted using leaf discs in an in vitro setting, which may not accurately reflect the responses of Monarch butterflies on living plants. This limitation undermines the foundation for the novel ecological theory proposed by the authors. If the observed phenomena could be validated using specifically engineered plant lines-such as those created through gene editing, knockdown, or overexpression of key enzymes involved in the synthesis of specific N,S-cardenolides - the findings would be substantially more compelling.

      Reviewer #2 (Public review):

      This study examined the effects of several cardenolides, including N,S-ring containing variants, on sequestration and performance metrics in monarch larvae. The authors confirm that some cardenolides, which are toxic to non-adapted herbivores, are sequestered by monarchs and enhance performance. Interestingly, N,S-ring-containing cardenolides did not have the same effects and were poorly sequestered, with minimal recovery in frass, suggesting an alternate detoxification or metabolic strategy. These N,S-containing compounds are also known to be less potent defences against non-adapted herbivores. The authors further report that mixtures of cardenolides reduce herbivore performance and sequestration compared to single compounds, highlighting the important role of phytochemical diversity in shaping plant-herbivore interactions.

      Overall, this study is clearly written, well-conducted and has the potential to make a valuable contribution to the field. However, I have one major concern regarding the interpretations of the mixture results. From what I understand of the methods, all tested mixtures contain all five compounds. As such, it is not possible to determine whether reduced performance and sequestration result from the complete mixture or from the presence of a single compound, such as voruscharin for performance and uscharin for sequestration. For instance, if all compounds except voruscharin (or uscharin) were combined, would the same pattern emerge? I suspect not, since the effects of the individual N,S-containing compounds alone are generally similar to those of the full mixture (Figure S3). By taking the average of all single compounds, the individual effects of the N,S-containing ones are being inflated by the non-N,S-containing ones (in the main text, Figure 4). In the mix, of course, they are not being 'diluted', as they are always present. This interpretation is further supported by the fact that in the equimolar mix, the relative proportion of voruscharin decreases (from 50% in the 'real mix'), and the target measurements of performance and sequestration tend to increase in the equimolar mix compared to the real mix.

      Despite this issue, the discussion of mixtures in the context of plant defence against both adapted and non-adapted herbivores is fascinating and convincing. The rationale that mixtures may serve as a chemical tool-kit that targets different sets of herbivores is compelling. The non-N,S cardenolides are effective against non-adapted herbivores and the N,S-containing cardenolides are effective against adapted herbivores. However, the current experiments focus exclusively on an adapted species. It would be especially interesting to test whether such mixtures reduce overall herbivory when both adapted and non-adapted species are present.

      It remains possible that mixtures, even in the absence of voruscharin or uscharin, genuinely reduce sequestration or performance; however, this would need to be tested directly to address the abovementioned concern.

      Thanks for these insightful reviews and your summary assessment. We certainly agree that ours was a laboratory study with a single specialized insect, and both mixtures types had all five compounds (controlling for total toxin concentration). Thus, our conclusion that combined effects of naturally occurring toxins (within the cardenolide class) have non-additive effects for the specialized sequestering monarch are constrained by our experimental conditions. In our assay we used two mixture types, equimolar and “natural” proportions. We acknowledge that the natural proportions will vary with plant age, damage history, etc. of the host plant, Asclepias curassavica. Our proportions were based on growing the plants a few different times under variable conditions. Although we did not conduct these experiments on non-adapted insects, we discuss a related experiment that was conducted with wild-type and genetically engineered Drosophila (Lopez-Goldar et al. 2024, PNAS). In sum, we appreciate the reviewers’ comments.

      Recommendations for the authors:

      Reviewing Editor Comments:

      (i) More convincingly justify the choice and ecological relevance of the "natural" cardenolide ratios, (ii) Clarify the interpretation of mixture effects, and (iii) more explicitly discuss the limitations of leaf-disc assays and the absence of non-adapted herbivores in light of the broader coevolutionary claims.

      Thank you for these suggestions. We have added several sentences of text to the Discussion section to make these points.

      Reviewer #1 (Recommendations for the authors):

      (1) Statistical analysis is missing from Figure 3 and Figure S3, making it difficult to assess the significance of the data.

      Much of the data in Fig. 3 is meant for descriptive presentation, with the main statistical analysis (contrast between N,S and non-N,S cardenolides given in the main text of the results. We have added treatment differences between the sequestration efficiencies to the figure as well.

      (2) To help readers intuitively understand how certain results (such as ECD and sequestration efficiency) were calculated, the authors can provide the equations used for these computations.

      Thank you, this was given in the methods and we have added it to the Result on first mention as well.

      (3) For Figure 4, we suggest presenting the results of the equal mixture treatment and the realistic mixture treatment separately, rather than averaging the results from these two types of treatments.

      We understand and appreciate this comment – all of the treatment means are given in Fig. S3. For this particular figure we have opted to stick with the binary comparison (singles vs. mixed) to maximize replication for statistical tests (typically n = 25 vs. 10).

      Reviewer #2 (Recommendations for the authors):

      Given the interpretations and discussion generally, I feel the manuscript would benefit from either additional experiments (mixtures w/o N-S compounds), inclusion of non-adapted herbivore performance, or reframing of the explicit interpretations from your findings.

      We have added some caveats to the text but not added any additional experiments.

      Also, for all treatments/mixtures are concentrations above the IC50? Perhaps this could be calculated from the information presented, but it may be best to explicitly mention this.

      This is an interesting question. IC50’s are estimated from in vitro assays (with the enzyme and toxins in microplate wells) and so are not translatable to foliar concentrations. As indicated in the text, we chose cardenolide levels based on foliar concentrations to match A. curassavica.

      Some minor points:

      (1) Although the intact N,S-ring-containing compounds are recovered in low amounts in frass (and not sequestered), is there evidence of N,S-ring components being otherwise traceable in the frass? For example, can excess S or N be detected in frass? This could provide insight into differential detoxification or reincorporation of these elements, potentially explaining variation between voruscharin and uscharin.

      Great question! We have not been able to detect breakdown projects. In other experiments we have conducted mass spectrometric analysis of bodies and frass, but have not been able to find the features representing breakdown products. Nonetheless, as mentioned below, the main conversion products are evident and measurable, as in this study.

      (2) As a point of curiosity, is there evidence of interconversion between such compounds? For instance, if monarchs are fed only voruscharin, can other cardenolides be detected in their tissues?

      Yes, we have tried to make this more clear in the text. Both uscharin and voruscharin are converted to calotropin and calactin.

    1. eLife Assessment

      This important study demonstrates that a peri-nuclear actomyosin network, present in some types of human cells, facilitates kinetochore-spindle attachment of chromosomes in unfavorable locations - thereby suppressing their missegregation rate. This actomyosin network and its general role have been studied previously, but this study convincingly clarifies the underlying mechanism using a light-controlled perturbation and detailed tracking of kinetochore movement. The generality of the mechanism could be further supported by confirming the findings in non-synchronized cells and additional cell lines. The results may have implications for understanding chromosome missegregation in cancer cells.

      [Editors' note: this paper was reviewed by Review Commons.]

    2. Reviewer #1 (Public review):

      Summary:

      Sheidaei and colleagues report a novel and potentially important role for an early mitotic actomyosin-based mechanism, PANEM contraction, in promoting timely congression of chromosomes located at the nuclear periphery, particularly those in polar positions. The manuscript will interest researchers studying cell division, cytoskeletal dynamics, and motor proteins. Although some data overlap with the group's prior work, the authors extend those findings by optimizing key perturbations and performing more detailed analyses of chromosome movements, which together provide a clearer mechanistic explanation. The study also builds naturally on recent ideas from other groups about how chromosome positioning influences both early and later mitotic movements.

      In its current form, however, the manuscript suffers from major organizational problems, an overcrowded and confusing Results section and figures, and a lack of essential experimental controls and contextual discussion. These deficiencies make it difficult to evaluate the data and the authors' conclusions. A substantial structural revision is required to improve clarity and persuasiveness. In addition, several key control experiments and more conceptual context are needed to establish the specificity and relevance of PANEM relative to other microtubule- and actin-based mitotic mechanisms. Testing PANEM in additional cell lines or contexts would also strengthen the claim. I therefore recommend addressing the structural, conceptual, and experimental issues detailed below.

      Major Comments:

      (1) Structural overhaul and figure reorganization<br /> The Results section is overly dense, lacks clear structure, and includes descriptive content that belongs in the Methods. Many figure panels should be moved to Supplementary Materials. A substantial reorganization is required to transform the manuscript into a focused, "Reports"-type article.<br /> - Move methodological and descriptive details (e.g., especially from the second Results subheading and Figure 2) to the Methods or Supplementary Materials.<br /> - Remove repetitive statements that simply restate that later phenotypes arise as consequences of delayed Phase 1 (applicable to subheadings 3 onward).<br /> - Figure 4I: This panel is currently unclear and should be drastically simplified.<br /> I recommend to reorganize figures as follows:<br /> - Figure I: Keep as single figure but simplify. Figure 1D and 1E could be combined, move unnormalized SCV to supplementary materials. Same goes for 1F.<br /> - New Figure 2: Combine current Figures 2A, 3A, 3C, 3D, 4C, 4F, and 4H to illustrate how PANEM contraction facilitates initial interactions of peripheral chromosomes with spindle microtubules which increases speed of congression initiation.<br /> - New Figure 3: Combine current Figures 5A, 5C, 5D, 5F, 6B, 6C, and lower panels of 4H to show how PANEM contraction repositions polar chromosomes and reduces chromosome volume in early mitosis to enable rapid initiation of congression.<br /> - New Figure 4: Combine Figures 7A, 7B, 7D, 7E, 7F, expanded Supplementary Figure S7, and new data to demonstrate that PANEM actively pushes peripheral chromosomes inward which is important for efficient chromosome congression in diverse cellular contexts.

      (2) Specificity and redundancy of actin perturbation<br /> To establish the specificity and relevance of PANEM, the authors should include or discuss appropriate controls:<br /> - Apply global actin inhibitors (e.g., cytochalasin D, latrunculin A) to disrupt the entire actin cytoskeleton. These perturbations strongly affect mitotic rounding and cytokinesis but only modestly influence early chromosome movements, as reported previously (Lancaster et al., 2013; Dewey et al., 2017; Koprivec et al., 2025). The minimal effect of global inhibition must be addressed when proposing a localized actomyosin mechanism. Comment if the apparent differences in this approach and one that the authors were using arises due to different cell types.<br /> - Clarify why spindle-associated actin, especially near centrosomes, as reported in prior studies using human cultured cells (Kita et al., 2019; Plessner et al., 2019; Aquino-Perez et al., 2024), was not observed in this study. The Myosin-10 and actin were also observed close to centrosomes during mitosis in X. laevis mitotic spindles (Woolner et al., 2008). Possible explanations include differences in fixation, probe selection, imaging methods, or cell type. Note that some actin probes (e.g., phalloidin) poorly penetrate internal actin, and certain antibodies require harsh extraction protocols. Comment on possibility that interference with a pool of Myo10 at the centrosomes is important for effects on congression.

      (3) Expansion of PANEM functional analysis<br /> To strengthen the conclusions and broaden the study beyond the group's previous work, PANEM function should be tested in additional contexts (some may be considered optional but important for broader impact):<br /> - Test PANEM function in at least one additional cell line that displays PANEM to rule out cell-line-specific effects.<br /> - Examine higher-ploidy or binucleated cells to determine whether multiple PANEM contractions are coordinated and if PANEM contraction contributes more in cells of higher ploidies or specific nuclear morphologies.<br /> - Investigate dependency on nuclear shape or lamina stiffness; test whether PANEM force transmission requires a rigid nuclear remnant.<br /> - Analyze PANEM's contribution under mild microtubule perturbations that are known to induce congression problems (e.g., low-dose nocodazole).<br /> - Evaluate PANEM contraction role in unsynchronized U2OS cells, where centrosome separation can occur before NEBD in a subset of cells (Koprivec et al., 2025), and in other cell types with variable spindle elongation timing.<br /> - Quantify not only the percentage of affected cells after azBB but also the number of chromosomes per cell with congression defects in the current and future experiments.

      (4) Conceptual integration in Introduction and Discussion<br /> The manuscript should better situate its findings within the context of early mitotic chromosome movements:<br /> - Clearly state in the Introduction and elaborate in the Discussion that initiation of congression is coupled to biorientation (Vukušić & Tolić, 2025). This provides essential context for how PANEM-mediated nuclear volume reduction supports efficient congression of polar chromosomes.<br /> - Explain that PANEM is most critical for polar chromosomes because their peripheral positions are unfavorable for rapid biorientation (Barišić et al., 2014; Vukušić & Tolić, 2025).<br /> - Discuss how cell lines lacking PANEM (e.g., HeLa and others) nonetheless achieve efficient congression, and what alternative mechanisms compensate in the absence of PANEM. For example, it is well established that cells congress chromosomes after monastrol or nocodazole washout, which essentially bypasses the contribution of PANEM contraction.

      Significance:

      Advance:<br /> This study's main strength is its novel and potentially important demonstration that contraction of PANEM, a peripheral actomyosin network that operates contracts early mitosis, contributes to the timely initiation of chromosome congression, especially for polar chromosomes. While PANEM itself was previously described by this group, this manuscript provides new mechanistic evidence, improved perturbations, and detailed chromosome tracking. To my knowledge, no prior studies have mechanistically connected this contraction to polar chromosome congression in this level of detail. The work complements dominant microtubule-centric models of chromosome congression and introduces actomyosin-based forces as a cooperating system during very early mitosis. However, the impact of the study is currently limited by major organizational issues, insufficient controls, and incomplete contextualization within existing literature.

      Audience:<br /> Primary audience of this study will be researchers working in cell division, mitosis, cytoskeleton dynamics, and motor proteins. The findings may interest also the wider cell biology community, particularly those studying chromosome segregation fidelity, spindle mechanics, and cytoskeletal crosstalk. If validated and clarified, the concept of PANEM could be integrated into textbooks and models of chromosome congression and could inform studies on mitotic errors and cancer cell mechanics.

      Expertise:<br /> My expertise lies in kinetochore-microtubule interactions, spindle mechanics, chromosome congression, and mitotic signaling pathways.

    3. Reviewer #2 (Public review):

      Summary:

      In this manuscript, Sheidaei et al. reported on their study of chromosome congression during the early stages of mitotic spindle assembly. Building on their previous study (ref. #15, Booth et al., eLife, 2019), they focused on the exact role of the actin-myosin-based contraction of the nuclear envelope. First, they addressed a technical issue from their previous study, finding a way to specifically impair the actomyosin contraction of the nuclear membrane without affecting the contraction of the plasma membrane. This allowed them to study the former more specifically. They then tracked individual kinetochores to reveal which were affected by nuclear membrane contraction and at what stage of displacement towards the metaphase plate. The investigation is rigorous, with all the necessary controls performed. The images are of high quality. The analyses are accurate and supported by convincing quantifications. In summary, they found that peripheral chromosomes, which are close to the nuclear membrane, are more influenced by nuclear membrane contraction than internal chromosomes. They discovered that nuclear membrane contraction primarily contributes to the initial displacement of peripheral chromosomes by moving them towards the microtubules. The microtubules then become the sole contributors to their motion towards the pole and subsequently the midplane. This step is particularly critical for the outermost chromosomes, which are located behind the spindle pole and are most likely to be mis-segregated.

      Significance:

      While the conclusions are somewhat intuitive and could be considered incremental with regard to previous works, they are solid and improve our understanding of mitotic fidelity. The authors had already reported the overall role of nuclear membrane contraction in reducing chromosome mis-segregation in their previous study, as mentioned fairly and transparently in the text. However, the reason for this is now described in more detail with solid quantification. Overall, this is good-quality work which does not drastically change our understanding of chromosome congression but contributes to improving it. Personally, I am surprised by the impact of such a small contraction (of around one micron) on the proper capture of chromosomes and wonder whether the signalling associated with the contraction has a local impact on microtubule dynamics. However, investigating this point is clearly beyond the scope of this study.

    4. Reviewer #3 (Public review):

      Summary:

      Sheidaei et al., report how chromosomes are brought to positions that facilitate kinetochore-microtubule interactions during mitosis. The study focusses on an important early step of the highly orchestrated chromosome segregation process. Studying kinetochore capture during early prophase is extremely difficult due to kinetochore crowding but the team has taken up the challenge by classifying the types of kinetochore movements, carefully marking kinetochore positions in early mitosis and linking these to map their fate/next-positions over time. The work is an excellent addition to the field as most of the literature has thus far focussed on tracking kinetochore in slightly later stages of mitosis. The authors show that the PANEM facilitates chromosome positioning towards the interior of the newly forming spindle, which in turn facilitates chromosome congression - in the absence of PANEM chromosomes end up in unfavourable locations, and they fail to form proper kinetochore-microtubule interactions. The work highlights the perinuclear actomyosin network in early mitosis (PANEM) as a key spatial and temporal element of chromosome congression which precedes the segregation process.

      Major Comments:

      (1) The complexity of tracking has been managed by classifying kinetochore movements into 4 categories, considering motions towards or away from the spindle mid-plane. While this is a very creative solution in most cases, there may be some difficult phases that involve movement in both directions or no dominant direction (e.g. Phase3-like). It is unclear if all kinetochores go through phase1, 2, 3 and 4 in a sequential or a few deviate from this pattern. A comment on this would be helpful. Also, it may be interesting to compare those that deviate from the sequence and ask how they recover in the presence and absence of azBB.

      (2) Would peripheral kinetochore close to poles behave differently compared to peripheral kinetochore close to the midplane (figure S4) ?In figure 3D, are they separated? If not, would it look different?

      (3) Uncongressed polar chromosomes (e.g., CENPE inhibited cells) are known to promote tumbling of the spindle. In figure 5B with polar chromosomes, it will be helpful to indicate how the authors decouple spindle pole movements from individual kinetochore movements.

      (4) The work has high quality manual tracking of objects in early mitosis- if this would be made available to the field, it can help build AI models for tracking. The authors could consider depositing the tracking data and increasing the impact of their work.

      Significance:

      The current work builds upon their previous work, in which the authors demonstrated that an actomyosin network forms on the cytoplasmic side of the nuclear envelope during prophase. This work explains how the network facilitates chromosome capture and congression by tracking motions of individual kinetochores during early mitosis. The findings can be broadly useful for cell division and the cytoskeletal fields.

    5. Author response:

      General Statements

      Our study provides important mechanistic insights into how the perinuclear actomyosin network PANEM facilitates the interaction of unfavorably positioned chromosomes, i.e. peripheral and polar chromosomes, with the mitotic spindle in early mitosis to ensure their correct segregation in subsequent anaphase. All reviewers agree that our study makes important contribution to the field of mitosis and chromosome segregation. They make positive comments on our manuscript, for example, ‘The work highlights the PANEM as a key spatial and temporal element of chromosome congression’, ‘The work is an excellent addition to the field’, and ‘the concept of PANEM could be integrated into textbooks and models of chromosome congression’. All three reviewers also acknowledge the high quality of the data, rigorous and accurate analyses, and convincing quantification in our study. Reviewers 1 and 3 give several comments and suggestions for revision of our manuscript. Please find our point-by-point revision plan of the manuscript from page 3.

      Description of the planned revisions

      Reviewer #1 (Evidence, reproducibility and clarity):

      Summary

      Sheidaei and colleagues report a novel and potentially important role for an early mitotic actomyosin-based mechanism, PANEM contraction, in promoting timely congression of chromosomes located at the nuclear periphery, particularly those in polar positions. The manuscript will interest researchers studying cell division, cytoskeletal dynamics, and motor proteins. Although some data overlap with the group's prior work, the authors extend those findings by optimizing key perturbations and performing more detailed analyses of chromosome movements, which together provide a clearer mechanistic explanation. The study also builds naturally on recent ideas from other groups about how chromosome positioning influences both early and later mitotic movements.

      In its current form, however, the manuscript is not acceptable for publication. It suffers from major organizational problems, an overcrowded and confusing Results section and figures, and a lack of essential experimental controls and contextual discussion. These deficiencies make it difficult to evaluate the data and the authors' conclusions. A substantial structural revision is required to improve clarity and persuasiveness. In addition, several key control experiments and more conceptual context are needed to establish the specificity and relevance of PANEM relative to other microtubule- and actin-based mitotic mechanisms. Testing PANEM in additional cell lines or contexts would also strengthen the claim. I therefore recommend Major Revision, addressing the structural, conceptual, and experimental issues detailed below.

      Major Comments

      A. Structural overhaul and figure reorganization

      The Results section is overly dense, lacks clear structure, and includes descriptive content that belongs in the Methods. Many figure panels should be moved to Supplementary Materials. A substantial reorganization is required to transform the manuscript into a focused, "Reports"-type article.

      Figure 4I: This panel is currently unclear and should be drastically simplified.

      We will follow this suggestion and simplify this figure. For example, we plan to remove the column of “Start” because it is obvious and does not provide much new information.

      I recommend to reorganize figures as follows:

      Figure I: Keep as single figure but simplify. Figure 1D and 1E could be combined, move unnormalized SCV to supplementary materials. Same goes for 1F.

      We will follow this suggestion and reorganize Figure 1 accordingly.

      New Figure 4: Combine Figures 7A, 7B, 7D, 7E, 7F, expanded Supplementary Figure S7, and new data to demonstrate that PANEM actively pushes peripheral chromosomes inward which is important for efficient chromosome congression in diverse cellular contexts.

      As suggested, we will conduct new experiments to demonstrate the role of PANEM in diverse cellular contexts, as detailed below. We will then combine the new results with Figure S7 to make the new Figure 8.

      On the other hand, in our view, combining Figure 7A-E and the extended Figure S7 would be confusing because the two parts address different topics. Although we respect this suggestion from the reviewer, we would like to keep Figure 7 and the extended Figure S7 (i.e. Figure 8) separate.

      C. Expansion of PANEM functional analysis

      To strengthen the conclusions and broaden the study beyond the group's previous work, PANEM function should be tested in additional contexts (some may be considered optional but important for broader impact): [underlined by authors]

      Test PANEM function in at least one additional cell line that displays PANEM to rule out cellline-specific effects.

      As suggested, we will study the effect of PANEM contraction in one or two additional cell lines that form PANEM during prophase. For example, we plan to inhibit the PANEM contraction and study the outcome, focusing on the generation of polar chromosomes, which is the major defect after the inhibition of PANEM contraction in U2OS cells.

      Evaluate PANEM contraction role in unsynchronized U2OS cells, where centrosome separation can occur before NEBD in a subset of cells (Koprivec et al., 2025), and in other cell types with variable spindle elongation timing.

      As suggested, we will investigate the outcome (e.g. generation of polar chromosomes) of reduced PANEM contraction in unsynchronized U2OS cells, and address whether the two subsets of cells, where centrosomes’ separation occurs before and after NEBD, show any difference in the outcome.

      D. Conceptual integration in Introduction and Discussion

      The manuscript should better situate its findings within the context of early mitotic chromosome movements:

      Clearly state in the Introduction and elaborate in the Discussion that initiation of congression is coupled to biorientation (Vukušić & Tolić, 2025). This provides essential context for how PANEM-mediated nuclear volume reduction supports efficient congression of polar chromosomes.

      To explain the new interpretation of our results more clearly, we plan to add a new diagram to a supplemental figure in the revised manuscript.

      Minor Comments

      Sixth subheading (currently in Discussion): Move the final paragraph of the Discussion into the Results and expand it with preliminary analyses linking PANEM contraction to congression efficiency across untreated cell types or under mild nocodazole treatment.

      As suggested, we will move the final paragraph of the Discussion to make a new final section in the Results. Moreover, as suggested, we will study the outcome of inhibiting PANEM contraction in cell lines other than U2OS, and add the results to the new final section in the Results.

      Significance

      Advance

      This study's main strength is its novel and potentially important demonstration that contraction of PANEM, a peripheral actomyosin network that operates contracts early mitosis, contributes to the timely initiation of chromosome congression, especially for polar chromosomes. While PANEM itself was previously described by this group, this manuscript provides new mechanistic evidence, improved perturbations, and detailed chromosome tracking. To my knowledge, no prior studies have mechanistically connected this contraction to polar chromosome congression in this level of detail. The work complements dominant microtubule-centric models of chromosome congression and introduces actomyosin-based forces as a cooperating system during very early mitosis. However, the impact of the study is currently limited by major organizational issues, insufficient controls, and incomplete contextualization within existing literature. Addressing these issues will substantially improve clarity and credibility. [underlined by authors]

      We have addressed or will address the underlined criticisms as detailed above.

      Audience

      Primary audience of this study will be researchers working in cell division, mitosis, cytoskeleton dynamics, and motor proteins. The findings may interest also the wider cell biology community, particularly those studying chromosome segregation fidelity, spindle mechanics, and cytoskeletal crosstalk. If validated and clarified, the concept of PANEM could be integrated into textbooks and models of chromosome congression and could inform studies on mitotic errors and cancer cell mechanics.

      Expertise

      My expertise lies in kinetochore-microtubule interactions, spindle mechanics, chromosome congression, and mitotic signaling pathways.

      Reviewer #2 (Evidence, reproducibility and clarity):

      In this manuscript, Sheidaei et al. reported on their study of chromosome congression during the early stages of mitotic spindle assembly. Building on their previous study (ref. #15, Booth et al., Elife, 2019), they focused on the exact role of the actin-myosin-based contraction of the nuclear envelope. First, they addressed a technical issue from their previous study, finding a way to specifically impair the actomyosin contraction of the nuclear membrane without affecting the contraction of the plasma membrane. This allowed them to study the former more specifically. They then tracked individual kinetochores to reveal which were affected by nuclear membrane contraction and at what stage of displacement towards the metaphase plate. The investigation is rigorous, with all the necessary controls performed. The images are of high quality. The analyses are accurate and supported by convincing quantifications. In summary, they found that peripheral chromosomes, which are close to the nuclear membrane, are more influenced by nuclear membrane contraction than internal chromosomes. They discovered that nuclear membrane contraction primarily contributes to the initial displacement of peripheral chromosomes by moving them towards the microtubules. The microtubules then become the sole contributors to their motion towards the pole and subsequently the midplane. This step is particularly critical for the outermost chromosomes, which are located behind the spindle pole and are most likely to be missegregated.

      Significance

      While the conclusions are somewhat intuitive and could be considered incremental with regard to previous works, they are solid and improve our understanding of mitotic fidelity. The authors had already reported the overall role of nuclear membrane contraction in reducing chromosome missegregation in their previous study, as mentioned fairly and transparently in the text. However, the reason for this is now described in more detail with solid quantification. Overall, this is good-quality work which does not drastically change our understanding of chromosome congression, but contributes to improving it. Personally, I am surprised by the impact of such a small contraction (of around one micron) on the proper capture of chromosomes and wonder whether the signalling associated with the contraction has a local impact on microtubule dynamics. However, investigating this point is clearly beyond the scope of this study, which can be published as it is. [underlined by authors]

      The suggested topic (underlined) is intriguing. However, we agree with the reviewer that it is beyond the scope of this paper. The reviewer recommends publication of our manuscript as it is. So, we do not plan a revision based on this reviewer’s comments.

      Reviewer #3:

      Sheidaei et al., report how chromosomes are brought to positions that facilitate kinetochoremicrotubule interactions during mitosis. The study focusses on an important early step of the highly orchestrated chromosome segregation process. Studying kinetochore capture during early prophase is extremely difficult due to kinetochore crowding but the team has taken up the challenge by classifying the types of kinetochore movements, carefully marking kinetochore positions in early mitosis and linking these to map their fate/next-positions over time. The work is an excellent addition to the field as most of the literature has thus far focussed on tracking kinetochore in slightly later stages of mitosis. The authors show that the PANEM facilitates chromosome positioning towards the interior of the newly forming spindle, which in turn facilitates chromosome congression - in the absence of PANEM chromosomes end up in unfavourable locations, and they fail to form proper kinetochore-microtubule interactions. The work highlights the perinuclear actomyosin network in early mitosis (PANEM) as a key spatial and temporal element of chromosome congression which precedes the segregation process.

      Major points

      (4) The work has high quality manual tracking of objects in early mitosis- if this would be made available to the field, it can help build AI models for tracking. The authors could consider depositing the tracking data and increasing the impact of their work.

      As suggested, we will include kinetochore tracking data as supplemental data in the revised manuscript.

      Minor points

      (2) Discussion point: If cells had not separated their centrosomes before NEBD, would PANEM still be effective? Perhaps the cancer cell lines or examples as shown in Figure 6A have some clues here.

      The same question has been raised by Reviewer #1’s major point. We will undergo new experiments to directly address this question in a revised manuscript. If we do not obtain interpretable results, we will discuss this issue further in the Discussion, as suggested.

      (3) Figure 7 cartoon shows misalignment leading to missegregation. It may be useful to consider this in the context of the centrosome directed kinetochore movements via pivoting microtubules. Is this process blocked in azBB-treated cells?

      This issue is closely relevant to point 2 above. As discussed above, we will first address this issue experimentally. If we do not obtain interpretable results, we will discuss this issue further in the Discussion.

      Description of the revisions that have already been incorporated in the transferred manuscript

      Reviewer #1 (Evidence, reproducibility and clarity):

      Summary

      Sheidaei and colleagues report a novel and potentially important role for an early mitotic actomyosin-based mechanism, PANEM contraction, in promoting timely congression of chromosomes located at the nuclear periphery, particularly those in polar positions. The manuscript will interest researchers studying cell division, cytoskeletal dynamics, and motor proteins. Although some data overlap with the group's prior work, the authors extend those findings by optimizing key perturbations and performing more detailed analyses of chromosome movements, which together provide a clearer mechanistic explanation. The study also builds naturally on recent ideas from other groups about how chromosome positioning influences both early and later mitotic movements.

      In its current form, however, the manuscript is not acceptable for publication. It suffers from major organizational problems, an overcrowded and confusing Results section and figures, and a lack of essential experimental controls and contextual discussion. These deficiencies make it difficult to evaluate the data and the authors' conclusions. A substantial structural revision is required to improve clarity and persuasiveness. In addition, several key control experiments and more conceptual context are needed to establish the specificity and relevance of PANEM relative to other microtubule- and actin-based mitotic mechanisms. Testing PANEM in additional cell lines or contexts would also strengthen the claim. I therefore recommend Major Revision, addressing the structural, conceptual, and experimental issues detailed below.

      Major Comments

      A. Structural overhaul and figure reorganization

      The Results section is overly dense, lacks clear structure, and includes descriptive content that belongs in the Methods. Many figure panels should be moved to Supplementary Materials. A substantial reorganization is required to transform the manuscript into a focused, "Reports"-type article.

      Remove repetitive statements that simply restate that later phenotypes arise as consequences of delayed Phase 1 (applicable to subheadings 3 onward).

      As suggested, we have removed the statement for the delayed start of Phase 2 for peripheral kinetochores in azBB-treated cells (Page 9, second paragraph). We have also simplified the statement for the delayed start of Phase 3 and Phase 4 to avoid repetition (Page 9, third paragraph; Page 10, second paragraph).

      B. Specificity and redundancy of actin perturbation

      To establish the specificity and relevance of PANEM, the authors should include or discuss appropriate controls:

      Apply global actin inhibitors (e.g., cytochalasin D, latrunculin A) to disrupt the entire actin cytoskeleton. These perturbations strongly affect mitotic rounding and cytokinesis but only modestly influence early chromosome movements, as reported previously (Lancaster et al., 2013; Dewey et al., 2017; Koprivec et al., 2025). The minimal effect of global inhibition must be addressed when proposing a localized actomyosin mechanism. Comment if the apparent differences in this approach and one that the authors were using arises due to different cell types.

      We did experiments along this line, using a dominant-negative LINC construct, in our previous study (Booth et al eLife 2019). LINC-DN should more specifically remove/reduce PANEM than the global actin inhibitors mentioned above. LINC-DN attenuated the reduction of CSV soon after NEBD and increased the number of polar chromosomes (Booth et al eLife 2019); i.e. in this regard, the outcome was similar to azBB treatment in the current study. One can expect that global actin inhibitors would also inhibit the PANEM formation and show effects similar to LINC-DN. By contrast, the indicated references reported that global actin inhibitors strongly affect mitotic rounding and cytokinesis but only modestly influence early chromosome movements, as pointed out by the reviewer. Such a difference may have arisen due to different cell types (e.g. some cells form the PANEM and others do not: Figure S7), a different extent in the inhibition of PANEM formation, and/or the inhibition of cell rounding and cytokinesis (e.g. if cytokinesis is more sensitive to inhibitors than is the PANEM formation, we may not observe the possible effects on early chromosome movements due to PANEM inhibition while cytokinesis is still affected). As suggested, we discussed this topic in the Discussion (page 15, second paragraph). 

      Clarify why spindle-associated actin, especially near centrosomes, as reported in prior studies using human cultured cells (Kita et al., 2019; Plessner et al., 2019; Aquino-Perez et al., 2024), was not observed in this study. The Myosin-10 and actin were also observed close to centrosomes during mitosis in X.laevis mitotic spindles (Woolner et al., 2008). Possible explanations include differences in fixation, probe selection, imaging methods, or cell type. Note that some actin probes (e.g., phalloidin) poorly penetrate internal actin, and certain antibodies require harsh extraction protocols. Comment on possibility that interference with a pool of Myo10 at the centrosomes is important for effects on congression.

      As the reviewer implies, we cannot rule out that we could not detect actin associated with the spindle or centrosomes because of the difference in methods or cell lines between the current study and the literature mentioned by the reviewer. We have therefore moderated our claim in the Discussion that ‘we did not detect any actin network inside the nucleus, on the spindle or between chromosomes’ by adding ‘at least, using the method and the cell line in the current study’ to this statement (Page 13, second paragraph). We have also cited the three references mentioned by the reviewer in the Discussion (Page 13, second paragraph). Regarding Myosin10, azBB (blebbistatin variant) should have negligible effects on class-X myosin, including Myosin-10 (Limouze et al 2004 [PMID 15548862]). It is therefore unlikely that the effects of azBB that we observed in the current study are due to the inhibition of Myosin-10. We have cited Woolner et al 2008 and another paper and discussed this topic in the Discussion (Page 13, second paragraph).

      C. Expansion of PANEM functional analysis

      Quantify not only the percentage of affected cells after azBB but also the number of chromosomes per cell with congression defects in the current and future experiments.

      It is tricky to count the number of chromosomes because they frequently overlap. Counting kinetochores is more feasible, but kinetochore signals show some non-specific background (e.g. those outside of the nucleus in prophase). We therefore quantified the chromosome volume at polar regions in azBB-treated cells (Figure 6C).

      D. Conceptual integration in Introduction and Discussion

      The manuscript should better situate its findings within the context of early mitotic chromosome movements:

      Clearly state in the Introduction and elaborate in the Discussion that initiation of congression is coupled to biorientation (Vukušić & Tolić, 2025). This provides essential context for how PANEM-mediated nuclear volume reduction supports efficient congression of polar chromosomes.

      It has been a widely accepted view in the field that chromosome congression precedes biorientation, since the publication in 2006 (Kapoor et al Science 2006). Very recently, this view has been challenged by the new publication (Vukušić & Tolić, Nat comm 2025), as indicated by this reviewer. We have mentioned this new model and discussed the new interpretation of our results based on this new model, in the Discussion (page 14; ‘It has been a widely accepted view…’).

      To explain the new interpretation of our results more clearly, we plan to add a new diagram to a supplemental figure in the revised manuscript.

      Explain that PANEM is most critical for polar chromosomes because their peripheral positions are unfavorable for rapid biorientation (Barišić et al., 2014; Vukušić & Tolić, 2025).

      We have included such a statement in the Discussion, as a part of the new interpretation of our results based on the new model that chromosome biorientation precedes congression (see above). We have also cited the indicated two papers.

      Discuss how cell lines lacking PANEM (e.g., HeLa and others) nonetheless achieve efficient congression, and what alternative mechanisms compensate in the absence of PANEM. For example, it is well established that cells congress chromosomes after monastrol or nocodazole washout, which essentially bypasses the contribution of PANEM contraction.

      Following this suggestion, we discussed three possible mechanisms that could compensate for a lack of PANEM and facilitate kinetochore-MT interaction and chromosome congression, based on previous literature (Page 16): 1) the enhanced assembly rate of spindle MTs may facilitate kinetochore-MT interactions in N-CIN+ cancer cells, 2) chromosome biorientation may precede congression more frequently to promote the congression towards the spindle midplane, and 3) the balance between CENP-E, Dynein and chromokinesin’s activities may incline to greater chromosome-arm ejection forces towards the spindle midplane.

      Minor Comments

      These issues are more easily addressable but will significantly improve clarity and presentation.

      Introduction

      Remove the reference to Figure 1A in the Introduction. The portion of Figure 1 and related text that recapitulates the authors' previous work should be incorporated into the Introduction, not the Results.

      As suggested in the second sentence of this comment, we have moved most of the second paragraph of the first section of Results to Introduction (Page 4) and cited Figure 1A and 1B in Introduction. We would like to keep the reference to Figure 1A in the Introduction, because showing the PANEM images at the beginning of the manuscript would help readers’ understanding of our study. In addition, citing Figure 1A in the Introduction is more consistent with the suggestion in the second sentence of this comment.

      Results (by subheading)

      First subheading: When introducing the ~8-minute early mitotic interval, cite additional studies that have characterized this period: Magidson et al., 2011 (Cell); Renda et al., 2022 (Cell Reports); Koprivec et al., 2025 (bioRxiv); Vukušić & Tolić, 2025 (Nat Commun); Barišić et al., 2013 (Nat Cell Biol).

      As suggested, we cited these references at the indicated part of the first section of the Results (page 5).

      Second subheading: Cite key reviews and foundational research on kinetochore architecture and sequential chromosome movement during early mitosis: Mussachio & Desai, 2017

      (Biology); Itoh et al., 2018 (Sci Rep); Magidson et al., 2011 (Cell); Vukušić & Tolić, 2025 (Nat Commun); Koprivec et al., 2025 (bioRxiv); Rieder & Alexander, 1990 (J Cell Biol); Skibbens et al., 1993 (J Cell Biol); Kapoor et al., 2006 (Science); Armond et al., 2015 (PLoS Comput Biol); Jaqaman et al., 2010 (J Cell Biol).

      Rieder & Alexander, 1990 (J Cell Biol) and Kapoor et al., 2006 (Science) have already been cited in the second section of the Results in the original manuscript. We agree that all other references should be cited in this manuscript, and they are now cited in the Introduction and/or Discussion where they fit best (e.g. Mussachio & Desai 2017 reviews the kinetochore in general and is therefore best cited in the Introduction).

      Third subheading: Clarify why some kinetochores on Figure 3A appear outside the white boundaries if these boundaries are intended to represent the nuclear envelope.

      We interpret that these are background signals in the cytoplasm, which do not come from kinetochores, because 1) before NEBD, they were outside of the nucleus, and 2) after NEBD, they did not show any characteristic kinetochore motions such as those towards a spindle pole (Phase 2) and the spindle mid-plane (Phase 4). We have commented on these background signals in the legend for Figure 3A.

      Fifth subheading: Cite studies on polar chromosome movements: Klaasen et al., 2022 (Nature); Koprivec et al., 2025 (bioRxiv). Clarify that Figure 5F displays only those kinetochores that initiated directed congression movements.

      These two references have already been cited and discussed in this Result section of our original manuscript. However, considering this suggestion, we have discussed more about polar chromosome movements reported by Koprivec et al (page 11). Meanwhile, the reviewer is correct about Figure 5F, and we have clarified this point in the Figure 5F legend.

      Discussion

      When discussing cortical actin, cite key reviews on its presence and function during mitosis:

      Kunda & Baum, 2009 (Trends Cell Biol); Pollard & O'Shaughnessy, 2019 (Annu Rev Biochem); Di Pietro et al., 2016 (EMBO Rep).

      As suggested, we have cited all these review papers in the Discussion (page 15), and mentioned the role of the cortical actin on the spindle orientation and positioning (Kunda & Baum, 2009; Di Pietro et al., 2016), as well as the function of the actomyosin ring on cytokinesis (Pollard & O'Shaughnessy, 2019).

      Significance

      Advance

      This study's main strength is its novel and potentially important demonstration that contraction of PANEM, a peripheral actomyosin network that operates contracts early mitosis, contributes to the timely initiation of chromosome congression, especially for polar chromosomes. While PANEM itself was previously described by this group, this manuscript provides new mechanistic evidence, improved perturbations, and detailed chromosome tracking. To my knowledge, no prior studies have mechanistically connected this contraction to polar chromosome congression in this level of detail. The work complements dominant microtubule-centric models of chromosome congression and introduces actomyosin-based forces as a cooperating system during very early mitosis. However, the impact of the study is currently limited by major organizational issues, insufficient controls, and incomplete contextualization within existing literature. Addressing these issues will substantially improve clarity and credibility. [underlined by authors]

      We have addressed or will address the underlined criticisms as detailed above.

      Audience

      Primary audience of this study will be researchers working in cell division, mitosis, cytoskeleton dynamics, and motor proteins. The findings may interest also the wider cell biology community, particularly those studying chromosome segregation fidelity, spindle mechanics, and cytoskeletal crosstalk. If validated and clarified, the concept of PANEM could be integrated into textbooks and models of chromosome congression and could inform studies on mitotic errors and cancer cell mechanics.

      Expertise

      My expertise lies in kinetochore-microtubule interactions, spindle mechanics, chromosome congression, and mitotic signaling pathways.

      Reviewer #2 (Evidence, reproducibility and clarity):

      In this manuscript, Sheidaei et al. reported on their study of chromosome congression during the early stages of mitotic spindle assembly. Building on their previous study (ref. #15, Booth et al., Elife, 2019), they focused on the exact role of the actin-myosin-based contraction of the nuclear envelope. First, they addressed a technical issue from their previous study, finding a way to specifically impair the actomyosin contraction of the nuclear membrane without affecting the contraction of the plasma membrane. This allowed them to study the former more specifically. They then tracked individual kinetochores to reveal which were affected by nuclear membrane contraction and at what stage of displacement towards the metaphase plate. The investigation is rigorous, with all the necessary controls performed. The images are of high quality. The analyses are accurate and supported by convincing quantifications. In summary, they found that peripheral chromosomes, which are close to the nuclear membrane, are more influenced by nuclear membrane contraction than internal chromosomes. They discovered that nuclear membrane contraction primarily contributes to the initial displacement of peripheral chromosomes by moving them towards the microtubules. The microtubules then become the sole contributors to their motion towards the pole and subsequently the midplane. This step is particularly critical for the outermost chromosomes, which are located behind the spindle pole and are most likely to be missegregated.

      Significance

      While the conclusions are somewhat intuitive and could be considered incremental with regard to previous works, they are solid and improve our understanding of mitotic fidelity. The authors had already reported the overall role of nuclear membrane contraction in reducing chromosome missegregation in their previous study, as mentioned fairly and transparently in the text. However, the reason for this is now described in more detail with solid quantification. Overall, this is good-quality work which does not drastically change our understanding of chromosome congression, but contributes to improving it. Personally, I am surprised by the impact of such a small contraction (of around one micron) on the proper capture of chromosomes and wonder whether the signalling associated with the contraction has a local impact on microtubule dynamics. However, investigating this point is clearly beyond the scope of this study, which can be published as it is. [underlined by authors]

      The suggested topic (underlined) is intriguing. However, we agree with the reviewer that it is beyond the scope of this paper. The reviewer recommends publication of our manuscript as it is. So, we do not plan a revision based on this reviewer’s comments.

      Reviewer #3:

      Sheidaei et al., report how chromosomes are brought to positions that facilitate kinetochoremicrotubule interactions during mitosis. The study focusses on an important early step of the highly orchestrated chromosome segregation process. Studying kinetochore capture during early prophase is extremely difficult due to kinetochore crowding but the team has taken up the challenge by classifying the types of kinetochore movements, carefully marking kinetochore positions in early mitosis and linking these to map their fate/next-positions over time. The work is an excellent addition to the field as most of the literature has thus far focussed on tracking kinetochore in slightly later stages of mitosis. The authors show that the PANEM facilitates chromosome positioning towards the interior of the newly forming spindle, which in turn facilitates chromosome congression - in the absence of PANEM chromosomes end up in unfavourable locations, and they fail to form proper kinetochore-microtubule interactions. The work highlights the perinuclear actomyosin network in early mitosis (PANEM) as a key spatial and temporal element of chromosome congression which precedes the segregation process.

      Major points

      (1) The complexity of tracking has been managed by classifying kinetochore movements into 4 categories, considering motions towards or away from the spindle mid-plane. While this is a very creative solution in most cases, there may be some difficult phases that involve movement in both directions or no dominant direction (eg Phase3-like). It is unclear if all kinetochores go through phase1, 2, 3 and 4 in a sequential or a few deviate from this pattern. A comment on this would be helpful. Also, it may be interesting to compare those that deviate from the sequence, and ask how they recover in the presence and absence of azBB.

      To respond to this comment, we would like to first clarify how we selected kinetochores for our analysis. We selected kinetochores that can be individually tracked. If kinetochore tracking was difficult (before the start of Phase 4 in control and azBB-treated cells or before observing the extended Phase 3 in azBB-treated cells) because of kinetochore crowding, we did not choose such kinetochores. We also did not include kinetochores close to spindle poles (within 4 µm) at NEBD in our analysis for the following two reasons: First, these kinetochores often did not show clear and rapid movements towards a spindle pole, which we used to define Phase 2. Second, although we referred to kinetochore co-localization with a microtubule signal for the start of Phase 2, this was difficult for kinetochores close to spindle poles because of a high density of microtubules. As requested, we have added this comment to the Method section (page 23).

      With the above selection, all selected kinetochores without azBB treatment (control) showed the poleward motion (Phase 2) and congression (Phase 4) in this order, though their extents were varied among kinetochores. All selected kinetochores with azBB treatment also showed the poleward motion (Phase 2), and some of them showed congression (Phase 4) after Phase 2. Then, Phase 1 and Phase 3 were defined as intervals between NEBD and Phase 2 and between Phase 2 and Phase 4, respectively. If no Phase 4 was observed with azBB, we judged that Phase 3 continued till the end of tracking. We have added this comment to the Method section (page 23-24).

      (2) Would peripheral kinetochore close to poles behave differently compared to peripheral kinetochore close to the midplane (figure S4)? In figure 3D, are they separated? If not, would it look different?

      Since we did not include kinetochores close to spindle poles (at NEBD), for which it was difficult to define Phase 2 (see our response to the above major point 1), in our analysis, the suggested comparison is not feasible.

      (3) Uncongressed polar chromosomes (eg., CENPE inhibited cells) are known to promote tumbling of the spindle. In figure 5B with polar chromosomes, it will be helpful to indicate how the authors decouple spindle pole movements from individual kinetochore movements.

      In contrast to CENPE-inhibited cells, azBB-treated cells did not show much tumbling of the spindle, though both cells showed uncongressed polar chromosomes. The reason for this difference may be fewer uncongressed polar chromosomes in azBB-treated cells. There were still modest spindle motions in azBB-treated cells. However, because kinetochore motions were assessed relative to a spindle pole (and other reference points on the spindle) in our study (Figure 2A, C), the modest spindle motions were offset in our analyses of kinetochore motions. We have clarified the underlined part in the Method section (page 22).

      Minor points

      (1) It will be helpful for readers to see how many kinetochores/cell were considered in the tracking studies. Figure legends show kinetochore numbers but not cell numbers.

      As suggested, we have now mentioned the number of cells, where the kinetochore motions were analyzed, in the legends for Figures 3, 4, 5, S4 and S5.

      (4) Are all the N-CIN- lines with PANEM highly sensitive to azBB? In other words, is PANEM essential for normal congression in some of these lines.

      We checked the sensitivity of cell lines in Figure S7B to blebbistatin (the original form of azBB) on DepMap. There was no plausible difference between PANEM+ and PANEM- cell lines, although the blebbistatin sensitivity data were available only for 4 cell lines (HCT116, MCF7, U2OS and HT29) in Figure S7B. Nonetheless, because blebbistatin could kill cells by inhibiting cytokinesis, the blebbistatin sensitivity may not necessarily reflect how essential the PANEM contraction is for chromosome congression.

      (5) Are congression times delayed in lines that naturally lack PANEM?

      For example, it takes 10-20 min for HeLa cells (lacking PANEM) to complete chromosome congression after the NEBD (Bancroft et al 2025: https://doi.org/10.1242/jcs.163659). This is not significantly different from the time (8-18 min) for chromosome congression we observed in U2OS cells (forming PANEM). We assume that cells lacking PANEM have developed a compensatory mechanism for efficient chromosome congression – we have newly discussed possible compensatory mechanisms in the last paragraph of the Discussion (page 16).

      (6) Page 23 "we first identified the end of congression" how does this relate to kinetochore oscillations that move kinetochores away from the metaphase plate?

      The start of kinetochore oscillation was defined as the end of Phase 4 if we could track the kinetochore until that point. In some cases where the kinetochore became close to the midplane (< 2.5 µm), it was not possible to track it further due to kinetochore crowding around the spindle mid-plane – in such cases, the end of Phase 4 was assigned as the end of tracking. In the original manuscript, it was not clear that the end of Phase 4 was defined in the same way for both non-polar and polar kinetochores, while the start of Phase 4 was defined differently for the two groups. This was confusing in the original manuscript. We have now clarified these points in the Method section (page 23).

      (7) Are spindle pole distances (spindle sizes) different in early and late mitotic cells (4min vs 6min after NEBD) in control vs azBB-treated cells? Please comment on Figure S2E (mean distance) in the context of when phase 4 is completed. Does spindle size return to normal after congression?

      In Figure S2E, we did not observe a significant difference in the spindle-pole distance (the spindle size) between control and azBB-treated cells at any individual time points. The smallest p-value was 0.094 at 6.0 min. As suggested, we have explained this in the legend for Figure S2E.

      Significance:

      The current work builds upon their previous work, in which the authors demonstrated that an actomyosin network forms on the cytoplasmic side of the nuclear envelope during prophase. This work explains how the network facilitates chromosome capture and congression by tracking motions of individual kinetochores during early mitosis. The findings can be broadly useful for cell division and the cytoskeletal fields.

      Description of analyses that authors prefer not to carry out

      Reviewer #1 (Evidence, reproducibility and clarity):

      Summary

      Sheidaei and colleagues report a novel and potentially important role for an early mitotic actomyosin-based mechanism, PANEM contraction, in promoting timely congression of chromosomes located at the nuclear periphery, particularly those in polar positions. The manuscript will interest researchers studying cell division, cytoskeletal dynamics, and motor proteins. Although some data overlap with the group's prior work, the authors extend those findings by optimizing key perturbations and performing more detailed analyses of chromosome movements, which together provide a clearer mechanistic explanation. The study also builds naturally on recent ideas from other groups about how chromosome positioning influences both early and later mitotic movements.

      In its current form, however, the manuscript is not acceptable for publication. It suffers from major organizational problems, an overcrowded and confusing Results section and figures, and a lack of essential experimental controls and contextual discussion. These deficiencies make it difficult to evaluate the data and the authors' conclusions. A substantial structural revision is required to improve clarity and persuasiveness. In addition, several key control experiments and more conceptual context are needed to establish the specificity and relevance of PANEM relative to other microtubule- and actin-based mitotic mechanisms. Testing PANEM in additional cell lines or contexts would also strengthen the claim. I therefore recommend Major Revision, addressing the structural, conceptual, and experimental issues detailed below.

      Major Comments

      A. Structural overhaul and figure reorganization

      The Results section is overly dense, lacks clear structure, and includes descriptive content that belongs in the Methods. Many figure panels should be moved to Supplementary Materials. A substantial reorganization is required to transform the manuscript into a focused, "Reports"-type article.

      Move methodological and descriptive details (e.g., especially from the second Results subheading and Figure 2) to the Methods or Supplementary Materials.

      In these parts, we define four phases of kinetochore motion in early mitosis. Without such a description in the main text, readers would be confused about subsequent analyses. Figure 2 is also important to show examples of how the four phases develop. Although we respect this suggestion from the reviewer, we would like to keep these parts in the main text and main figure.

      New Figure 2: Combine current Figures 2A, 3A, 3C, 3D, 4C, 4F, and 4H to illustrate how PANEM contraction facilitates initial interactions of peripheral chromosomes with spindle microtubules which increases speed of congression initiation.

      If we were to follow this suggestion, we would lose Figure 2B, D, Figure 3B and Figure 4A, where examples of kinetochore motions are shown in images and 3D diagrams. The new Figure would mostly consist of only graphs. Without examples of images and 3D diagrams, readers would have difficulty understanding the study. Although we respect this suggestion from the reviewer, we would like to keep Figures 2, 3 and 4, as they are (except for making Figure 4I simpler; see above).

      New Figure 3: Combine current Figures 5A, 5C, 5D, 5F, 6B, 6C, and lower panels of 4H to show how PANEM contraction repositions polar chromosomes and reduces chromosome volume in early mitosis to enable rapid initiation of congression.

      If we were to follow this suggestion, we would lose Figure 5B and Figure 6A, where examples of kinetochore/chromosome dynamics are shown in images and 3D diagrams. For the same reason as above, we would like to keep Figure 5 and 6 as they are, although we respect this suggestion from the reviewer.

      New Figure 4: Combine Figures 7A, 7B, 7D, 7E, 7F, expanded Supplementary Figure S7, and new data to demonstrate that PANEM actively pushes peripheral chromosomes inward which is important for efficient chromosome congression in diverse cellular contexts.

      As suggested, we will conduct new experiments to demonstrate the role of PANEM in diverse cellular contexts, as detailed below. We will then combine the new results with Figure S7 to make the new Figure 8.

      On the other hand, in our view, combining Figure 7A-E and the extended Figure S7 would be confusing because the two parts address different topics. Although we respect this suggestion from the reviewer, we would like to keep Figure 7 and the extended Figure S7 (i.e. Figure 8) separate.

      B. Specificity and redundancy of actin perturbation

      To establish the specificity and relevance of PANEM, the authors should include or discuss appropriate controls:

      Examine higher-ploidy or binucleated cells to determine whether multiple PANEM contractions are coordinated and if PANEM contraction contributes more in cells of higher ploidies or specific nuclear morphologies.

      This is an interesting suggestion, but it takes lots of time to conduct such a study, and it goes beyond the scope of this paper.

      Investigate dependency on nuclear shape or lamina stiffness; test whether PANEM force transmission requires a rigid nuclear remnant.

      This is an interesting suggestion, but it takes lots of time to conduct such a study, and it goes beyond the scope of this paper.

      Analyze PANEM's contribution under mild microtubule perturbations that are known to induce congression problems (e.g., low-dose nocodazole).

      In the current study, we found that PANEM contraction affects chromosome motions in Phase 1 and Phase 3 but not Phase 2 or Phase 4. Mild microtubule perturbation itself could affect chromosome motions in all four Phases. We do not think it would be so informative to study what additional effects the reduced PANEM contraction shows when combined with mild microtubule perturbation.

      D. Conceptual integration in Introduction and Discussion

      The manuscript should better situate its findings within the context of early mitotic chromosome movements:

      Minor Comments

      These issues are more easily addressable but will significantly improve clarity and presentation.

      Results (by subheading)

      Fourth subheading: Note that congression speed is lower for centrally located kinetochores because they achieve biorientation more rapidly (Barišić et al., 2013, Nat Cell Biol; Vukušić & Tolić, 2025, Nat Commun).

      We respect this comment. However, if biorientation were established more rapidly for centrally located kinetochores, it would advance the initiation of congression, but would not necessarily change congression speed.

    1. eLife Assessment

      The study showcases a significant and important enhancement of the MAGIC transgenesis method, by extending it genome-wide to all chromosomes. The authors provide compelling evidence to demonstrate that the MAGIC mosaic clones can be generated for genes from all, including the 4th chromosome. With this toolkit extension, the method is set to complement the classical FRT/Flp recombination system for gene manipulation in flies.

    2. Reviewer #1 (Public review):

      Summary:

      In this manuscript, Shen et al. have improved upon the mitotic clone analysis tool MAGIC that their lab previously developed. MAGIC uses CRISPR/Cas9-mediated double-stranded breaks to induce mitotic recombination. The authors have replaced the sgRNA scaffold with a more effective scaffold to increase clone frequency. They also introduced modifications to positive and negative clonal markers to improve signal-to-noise and mark the cytoplasm of the cells instead of the nuclei. The changes result in increase in clonal frequencies and marker brightness. The authors also generated the MAGIC transgenics to target all chromosome arms and tested the clone induction efficacy.

      Strengths:

      MAGIC is a mitotic clone generation tool that works without prior recombination to special chromosomes (e.g., FRT). It can also generate mutant clones for genes for which the existing FRT lines could not be used (e.g., the genes that are between the FRT transgene and the centromere).

      This manuscript does a thorough job in describing the method and provides compelling data that support improvement over the existing method.

    3. Reviewer #2 (Public review):

      Summary:

      In this study, the authors present the latest improvement of their previously published methods, pMAGIC and nMAGIC, which can be used to engineer mosaic gene expression in wild-type animals and in a tissue-specific manner. They address the main limitation of MAGIC, the lack of gRNA-marker transgenes, which has hampered the broader adoption of MAGIC in the fly community. To do so, they create an entire toolkit of gRNA markers for every Drosophila chromosome and test them across a range of different tissues and in the context of making Drosophila species hybrid mosaic animals. The study provides a significant and broadly useful improvement compared to earlier versions, as it broadens the use-cases for transgenic manipulation with MAGIC to virtually any subfield of Drosophila cell biology.

      Strengths:

      Major improvements to MAGIC were made in terms of clone induction efficiency and usability across the Drosophila model system, including wild-type genotypes and the use in non-melanogaster species.

      Notably, mosaic mutants can now be created for genes residing on the 4th chromosome, which is exciting and possibly long-awaited by 4th chromosome gene enthusiasts.

      Selection of the standard set of gRNA markers was done thoughtfully, using non-repetitive conserved and unique sequences.

      The authors demonstrate that MAGIC can be used easily in the context of interspecific hybrids. I believe this is a great advancement for the Drosophila community, especially for evolutionary biologists, because this may allow for easy access to mechanistic, tissue-specific insight into the process of a range of hybrid incompatibilities, an important speciation process that is normally difficult to study at the level of molecular and cell biology.

      In the same way, because it is not limited to usage in any particular genetic background, genome-wide MAGIC can be potentially used in wild-type genotypes relatively easily. This is exciting, especially because natural genetic diversity is rarely investigated more mechanistically and at the scale/resolution of cells or specific tissues. Now, one can ask how a particular naturally occurring allele influences cell physiology compared to another (control) while keeping the global physiological context of the particular genetic background largely intact.

    4. Reviewer #3 (Public review):

      Summary:

      In the manuscript by Shen, Yeung, and colleagues, the authors generate an improved and expanded Mosaic analysis by gRNA-induced crossing-over (MAGIC) toolkit for use in making mosaic clones in Drosophila. This is a clever method by which mitotic clones can be induced in dividing cells by using CRISPR/Cas9 to generate double-strand breaks at specific locations that induce crossing over at those locations. This is conceptually similar to previous mosaic methods in flies that utilized FRT sites that had been inserted near centromeres along with heat-shock inducible FLPase. The advantage of the MAGIC system is that it can be used along with chromosomes lacking FRT sites already introduced, such as those found in many deficiency collections or in EMS mutant lines. It may also be simpler to implement than FRT-based mosaic systems. There are two flavors of the MAGIC system: nMAGIC and pMAGIC. In nMAGIC, the main constituents are a transgene insertion that contains gRNAs that target DNA near the centromere, along with a fluorescent marker. In pMAGIC, the main constituents are a transgenic insertion that contains gRNAs that target DNA near the centromere, along with ubiquitous expression of GAL80. As such, nMAGIC can be used to generate clones that are not labelled, whereas pMAGIC (along with a GAL4 line and UAS-marker) can be used much like MARCM to positively label a clone of cells. This manuscript introduces MAGIC transgenic reagents that allow all 4 chromosomes to be targeted. They demonstrate its use in a variety of tissues, including with mutants not compatible with current FLP/FRT methods, and also show it works well in tissues that prove challenging for FLP/FRT mosaic analyses (such as motor neurons). They further demonstrate that it can be used to generate mosaic clones in non-melanogaster hybrid tissues. Overall, this work represents a valuable improvement to the MAGIC method that should promote even more widespread adoption of this powerful genetic technique.

      Strengths:

      (1) Improves the design of the gRNA-marker by updating the gRNA backbone and also the markers used. GAL80 now includes a DE region that reduces the perdurance of the protein and thus better labeling of pMAGIC clones. The data presented to demonstrate these improvements is rigorous and of high quality.

      (2) Introduces a toolkit that now covers all chromosome arms in Drosophila. In addition, the efficiency of 3 target different sites is characterized for each chromosome arm (e.g., 3 different gRNA-Marker combinations), which demonstrate differences in efficiency. This could be useful to titrate how many clones an experimenter might want (e.g., lower efficiency combinations might prove advantageous).

      (3) The manuscript is well written and easy to follow. The authors achieved their aims of creating and demonstrating MAGIC reagents suitable for mosaic analysis of any Drosophila chromosome arm.

      (4) The MAGIC method is a valuable addition to the Drosophila genetics toolkit, and the new reagents described in this manuscript should allow it to become more widely adopted.

      Comments on revised version:

      The authors have done a great job addressing reviewer concerns with the addition of updated figures, new experiments, and changes to the manuscript. I am supportive of this version and agree with the updated assessment.

    5. Author response:

      The following is the authors’ response to the original reviews.

      We greatly appreciate the reviewers’ constructive comments and have followed their recommendations to improve our manuscript. These improvements include additional experiments, new analyses, and a rewriting of the text. We believe these changes significantly improved the paper and hope the editor and the reviewers agree. The following is a summary of the major changes made and our point-by-point response to reviewers’ comments.

      Summary of major changes:

      (1) Expanded labeling options: We generated a new nMAGIC vector containing miRFP680 as an infrared fluorescent protein (IFP) marker. We used gRNA-40D2(IFP) to demonstrate clones labeled by this marker in the wing imaginal disc (Figure 1M). This vector is available via Addgene for the generation of new gRNA-markers with our recommended or customer-designed gRNA target sequences.

      (2) Validated Gal80 potency: We provide new data in Figure 1E demonstrating complete suppression of pxn-Gal4>CD4-tdTom by tub-GAL80-DE-SV40. The exact transgenes used in the comparisons are clarified in the figure and figure legend.

      (3) Verified clone fitness: We compared the sizes of nMAGIC twin spots in wing discs and found no intrinsic growth or viability bias between marker/marker and WT/WT clones (Figure 1O).

      (4) Methodological Schematics: We added supplemental figures to Figure 1 to illustrate the principle of MAGIC, the difference between pMAGIC and nMAGIC, and an example of pMAGIC crossing scheme.

      (5) Inducible induction: We provide new data (Figure 3J-K’) showing the induction of sparse neuronal clones in the adult brain by heat shock (hs)-Cas9.

      (6) We revised texts to incorporate all other recommendations suggested by the reviewers. We also made other small changes to the manuscript to improve its readability.

      Public Reviews:

      Reviewer #1 (Public review):

      Summary:

      In this manuscript, Shen et al. have improved upon the mitotic clone analysis tool MAGIC that their lab previously developed. MAGIC uses CRISPR/Cas9-mediated double-stranded breaks to induce mitotic recombination. The authors have replaced the sgRNA scaffold with a more effective scaffold to increase clone frequency. They also introduced modifications to positive and negative clonal markers to improve signal-to-noise and mark the cytoplasm of the cells instead of the nuclei. The changes result in increase in clonal frequencies and marker brightness. The authors also generated the MAGIC transgenics to target all chromosome arms and tested the clone induction efficacy.

      Strengths:

      MAGIC is a mitotic clone generation tool that works without prior recombination to special chromosomes (e.g., FRT). It can also generate mutant clones for genes for which the existing FRT lines could not be used (e.g., the genes that are between the FRT transgene and the centromere).

      This manuscript does a thorough job in describing the method and provides compelling data that support improvement over the existing method.

      Weaknesses:

      It would be beneficial to have a greater variety of clonal markers for nMAGIC. Currently, the only marker is BFP, which may clash with other genetic tools (e.g., some FRET probes) depending on the application. It would be nice to have far-red clonal markers.

      We thank the reviewer for the positive comments about our study. We agree with the reviewer that adding a far-red option for nMAGIC increases the flexibility of this method. We replaced the BFP coding sequence in the nMAGIC cloning vector pAC-U63-QtgRNA2.1-tubBFP(HA) with that of miRFP680-T2A-HO1. We then used the resulting cloning vector to make a gRNA-40D2(IFP) transgene and tested it in the wing disc. Result showing clones in the wing disc are now in Figure 1M. The new cloning vector, along with others reported in our study, are available from Addgene.

      Reviewer #2 (Public review):

      Summary:

      In this study, the authors present the latest improvement of their previously published methods, pMAGIC and nMAGIC, which can be used to engineer mosaic gene expression in wild-type animals and in a tissue-specific manner. They address the main limitation of MAGIC, the lack of gRNA-marker transgenes, which has hampered the broader adoption of MAGIC in the fly community. To do so, they create an entire toolkit of gRNA markers for every Drosophila chromosome and test them across a range of different tissues and in the context of making Drosophila species hybrid mosaic animals. The study provides a significant and broadly useful improvement compared to earlier versions, as it broadens the use-cases for transgenic manipulation with MAGIC to virtually any subfield of Drosophila cell biology.

      Strengths:

      Major improvements to MAGIC were made in terms of clone induction efficiency and usability across the Drosophila model system, including wild-type genotypes and the use in non-melanogaster species.

      Notably, mosaic mutants can now be created for genes residing on the 4th chromosome, which is exciting and possibly long-awaited by 4th chromosome gene enthusiasts.

      Selection of the standard set of gRNA markers was done thoughtfully, using non-repetitive conserved and unique sequences.

      The authors demonstrate that MAGIC can be used easily in the context of interspecific hybrids. I believe this is a great advancement for the Drosophila community, especially for evolutionary biologists, because this may allow for easy access to mechanistic, tissue-specific insight into the process of a range of hybrid incompatibilities, an important speciation process that is normally difficult to study at the level of molecular and cell biology.

      In the same way, because it is not limited to usage in any particular genetic background, genome-wide MAGIC can be potentially used in wild-type genotypes relatively easily. This is exciting, especially because natural genetic diversity is rarely investigated more mechanistically and at the scale/resolution of cells or specific tissues. Now, one can ask how a particular naturally occurring allele influences cell physiology compared to another (control) while keeping the global physiological context of the particular genetic background largely intact.

      Weaknesses:

      It is not entirely clear how functionally non-critical regions were evaluated, besides that they are selected based on conservation of sequence between species. It may be useful to directly test the difference in viability or other functionally relevant phenotype for flies carrying different markers. Similarly, the frequency of off-targets could be investigated or documented in a bit more detail, especially if one of the major use-cases is meant for naturally derived, diverse genetic backgrounds. It is, at the moment, unclear how consistently the clones are induced for each new gRNA marker across different WT genetic backgrounds, for example, a set of DGRP genotypes, which could be highly useful information for future users.

      We thank the reviewer for the positive comments about our study. The reviewer raises an excellent point regarding the consistency of clone induction and potential background effects in diverse genetic backgrounds. As a standard step in building the MAGIC kit, we tested all gRNA-marker transgenes with the Cas9-LEThAL assay (Poe et al., Genetics, 2019), in which the gRNA-marker transgene was crossed to lig4 Act5C-Cas9 homozygotes. All crosses led to viable and apparently healthy female progeny, suggesting that ubiquitously mutating the chosen gRNA targeting sites does not cause obvious defects.

      For standard mutant analysis, we recommend researchers to use a well-characterized wildtype chromosome as a negative control. For studies utilizing diverse wildtype backgrounds where a standard control chromosome is inapplicable (e.g., DGRP screens), we recommend an internal validation strategy: researchers should confirm their key phenotypic findings by inducing clones with a second, independent gRNA-marker located on the same chromosomal arm (e.g., comparing clones induced by gRNA-40D2 vs. gRNA-40D4 ). This ensures that any observed phenotypes or variations in clone induction are linked to the selected genetic background rather than an off-target artifact or target-site specific effect.

      We admit that the above approach may not resolve concerns about off-targets. Performing deep sequencing to map empirical off-targets for all 34 gRNA pairs across multiple genetic backgrounds is experimentally prohibitive for a toolkit resource. However, our in silico selection pipeline strictly required target sequences to be unique within the D. melanogaster genome to mathematically minimize off-target probability. In addition, our requirement that target sequences be conserved in closely related Drosophila species acts as a stringent filter against intraspecies variation. Sequences conserved across species are subject to purifying selection, substantially reducing the likelihood that SNPs within the DGRP lines will disrupt the PAM or seed sequences required for Cas9 induction.

      Reviewer #3 (Public review):

      Summary:

      In the manuscript by Shen, Yeung, and colleagues, the authors generate an improved and expanded Mosaic analysis by gRNA-induced crossing-over (MAGIC) toolkit for use in making mosaic clones in Drosophila. This is a clever method by which mitotic clones can be induced in dividing cells by using CRISPR/Cas9 to generate double-strand breaks at specific locations that induce crossing over at those locations. This is conceptually similar to previous mosaic methods in flies that utilized FRT sites that had been inserted near centromeres along with heat-shock inducible FLPase. The advantage of the MAGIC system is that it can be used along with chromosomes lacking FRT sites already introduced, such as those found in many deficiency collections or in EMS mutant lines. It may also be simpler to implement than FRT-based mosaic systems. There are two flavors of the MAGIC system: nMAGIC and pMAGIC. In nMAGIC, the main constituents are a transgene insertion that contains gRNAs that target DNA near the centromere, along with a fluorescent marker. In pMAGIC, the main constituents are a transgenic insertion that contains gRNAs that target DNA near the centromere, along with ubiquitous expression of GAL80. As such, nMAGIC can be used to generate clones that are not labelled, whereas pMAGIC (along with a GAL4 line and UAS-marker) can be used much like MARCM to positively label a clone of cells. This manuscript introduces MAGIC transgenic reagents that allow all 4 chromosomes to be targeted. They demonstrate its use in a variety of tissues, including with mutants not compatible with current FLP/FRT methods, and also show it works well in tissues that prove challenging for FLP/FRT mosaic analyses (such as motor neurons). They further demonstrate that it can be used to generate mosaic clones in non-melanogaster hybrid tissues. Overall, this work represents a valuable improvement to the MAGIC method that should promote even more widespread adoption of this powerful genetic technique.

      Strengths:

      (1) Improves the design of the gRNA-marker by updating the gRNA backbone and also the markers used. GAL80 now includes a DE region that reduces the perdurance of the protein and thus better labeling of pMAGIC clones. The data presented to demonstrate these improvements is rigorous and of high quality.

      (2) Introduces a toolkit that now covers all chromosome arms in Drosophila. In addition, the efficiency of 3 target different sites is characterized for each chromosome arm (e.g., 3 different gRNA-Marker combinations), which demonstrate differences in efficiency. This could be useful to titrate how many clones an experimenter might want (e.g., lower efficiency combinations might prove advantageous).

      (3) The manuscript is well written and easy to follow. The authors achieved their aims of creating and demonstrating MAGIC reagents suitable for mosaic analysis of any Drosophila chromosome arm.

      (4) The MAGIC method is a valuable addition to the Drosophila genetics toolkit, and the new reagents described in this manuscript should allow it to become more widely adopted.

      Weaknesses:

      (1) The MAGIC method might not be well known to most readers, and the manuscript could have benefited from schematics introducing the technique.

      We thank the reviewer for the positive evaluation of our study and for making this kind suggestion. We have added diagrams that explain the principle of MAGIC and the difference between pMAGIC and nMAGIC in Figure 1 - Figure Supplement 1.

      (2) Traditional mosaic analyses using the FLP/FRT system have strongly utilized heat-shock FLPase for inducible temporal control over mitotic clones, as well as a way to titrate how many clones are induced (e.g., shorter heat shocks will induce fewer clones). This has proven highly valuable, especially for developmental studies. A heat-shock Cas9 is available, and it would have been beneficial to determine the efficiency of inducing MAGIC clones using this Cas9 source.

      We thank the reviewer for suggesting this experiment. We agree that demonstrating inducible clone induction in the adult brain is an effective way for people to compare MAGIC with the MARCM method they are probably more familiar with. We used a heat shock Cas9 developed by the Tzumin Lee group (Chen et al., Development, 2020) to experiment with clone induction, and the results are shown in the new Figure 3 (K and J). We show that, with a pan-neuronal Gal4, heat shock during the wandering 3rd instar larval stage induced more clones than during the pupal stage, and the later heat shock readily produced sparsely labeled neurons whose single-cell morphology can be easily visualized.

      Recommendations for the authors:

      Reviewing Editor Comments:

      The following are some consolidated review remarks after discussions amongst all three reviewers:

      The reviewers feel the evidence level could be raised from 'convincing' to 'compelling' if the following key (and partially shared) suggestions by the reviewers are followed adequately:

      (1) Expand labeling options for nMAGIC, which is currently just a BFP marker. This would increase the utility of the method. A far-red marker would be very helpful. Could the authors just do this for one chromosome arm and make the reagent available for others to generate other chromosome arms?

      We agree with the editor and reviewers that adding a far-red option for nMAGIC increases the flexibility of this method. We replaced the BFP coding sequence in the nMAGIC cloning vector pAC-U63-QtgRNA2.1-tubBFP(HA) with that of miRFP680-T2A-HO1. We then used the resulting cloning vector to make a gRNA-40D2(IFP) transgene and tested it in the wing disc. Result showing clones in the wing disc are now in Figure 1M. The new cloning vector, along with others reported in our study, will be available from Addgene.

      (2) Verify that destabilized GAL80 is potent enough to suppress GAL4. Repeat Figure 1C-E with tub-GAL80-DE-SV40.

      We replaced the experiment using gRNA-42A4-tDES, which successfully achieved complete suppression of pxn>CD4-tdTom (Figure 1E).

      (3) Concern about the health of the induced mitotic clones. This is an important consideration, but the reviewers were not sure what the necessary experiments would be. To gauge twin-spot clone sizes? Please address.

      We agree that clone fitness is an important consideration for MAGIC experiments. To test it, we generated WT clones in the wing imaginal disc using nMAGIC and quantified the sizes of the twin spots (BFP/BFP and WT/WT clones). Our results show that there is no statistical difference between these two types of clones. Thus, there is no intrinsic growth disadvantage to either type of mitotic clones generated by MAGIC.

      (4) Include a schematic of the MAGIC method as Figure 1 or add it to Figure 1. Many may not be familiar with the method, so to promote its adoption, the authors should clearly introduce the MAGIC method in this paper (and not rely on readers to go to previous publications). For this paper to become a MAGIC reference paper, it should be self-contained.

      We thank the reviewers for this suggestion. We have added diagrams that explain the principle of MAGIC and the difference between pMAGIC and nMAGIC in Figure 1 - Figure Supplement 1.

      (5) Determine the utility of using a hs-Cas9 line for temporal induction of MAGIC clones. This is a traditional method for mitotic clone induction (with hsFLP/FRTs), and its use with the MAGIC system (especially pMAGIC) could also make it more attractive, especially to label small populations of neurons born at known times. To this point, the authors could generate pMAGIC clones using hs-Cas9 for commonly used adult target neurons, such as projection neurons, central complex neurons, or mushroom body neurons. The method to label small numbers of these adult neurons is well worked out with known GAL4 lines, and demonstrating that pMAGIC could have similar results would capture the attention of many not familiar with the pMAGIC method.

      We agree that demonstrating inducible clone induction in the adult brain is an effective way for people to compare MAGIC with the MARCM method they are probably more familiar with. We used a heat shock Cas9 developed by the Tzumin Lee group (GarciaMarques, Espinosa-Medina et al. 2020) to experiment with clone induction, and the results are shown in the new Figure 3 (J-K’). We show that, with a pan-neuronal Gal4, heat shock during wandering 3rd instar larval stage induced more clones than during the pupal stage, and the later heat shock readily produced sparsely labeled neurons whose single-cell morphology can be easily visualized.

      Reviewer #1 (Recommendations for the authors):

      This is a marked improvement over the existing methods that the authors' lab has previously generated. It will be a nice addition to the Drosophila genetic tool kit after minor revisions.

      We appreciate the reviewer’s recognition of the new tools we developed.

      Minor issues:

      (1) In the data in Figures 1G and H, it is not ideal to compare the effect of different modifications on two different transgenes. uH and uDEH are compared in gRNA-40D2, whereas uDEH, tDEH, and tDES are compared in gRNA-42A4. If the transgenics are already available, it would be better to compare the uH, uDEH, tDEH, and tDES on either gRNA-40D2 or gRNA-42A4.

      We appreciate the reviewer’s concern. These transgenes were developed during different phases of this project. We first adopted the uDEH design during improvement of gRNA40D2, which solved both the leaky activity of pxn-Gal4 and dim epidermal clones. However, when we tried to expand this design to 2R (such as 42A4), we found that the clones were still too dim (probably due to positional effects). Thus, we next used uDEH in gRNA-42A4 as a base for further improvements. We did not make a uH version for gRNA-42A4 because we already knew that it is inferior to uDEH. Because of this history, we did not have the full set for gRNA42A4.

      Despite the lack of uH for gRNA-42A4, we believe our comparisons of different designs are still valid, given that uH and uDEH were compared with identical sequences elsewhere in the transgenic vector (including the gRNA target sequence) and in the identical insertion site.

      (2) It is not clear whether the authors tested destabilized Gal80 is potent to suppress Gal4 (e.g., in suppressing pxn>CD4-tdTom in hemocytes). The results in Figure 1C-E should be repeated with tub-Gal80-DE-SV40.

      We apologize for omitting the transgene identities in these experiments. We have redone the experiment using gRNA-42A4-tDES and updated the figures to clearly indicate which transgenes were used.

      (3) The difference in sgRNA scaffolds can be better explained in the text. The explanation here is very bare bones and reads like jargon. (i.e., changing F+E gRNA scaffold with gRNA2.1 scaffold is not a sufficient explanation).

      We have added more explanations to the differences between the scaffolds as suggested.

      (4) The stocks should be sent to Bloomington Stock Center to ensure widespread adoption of the method. This includes the Cas9 lines that are generated and used.

      It is our plan to freely share the reagents developed in this study with the community. Most of the fly lines are already available at Bloomington (https://bdsc.indiana.edu/stocks/misc/magic.html and https://bdsc.indiana.edu/stocks/genome_editing/crispr_cas9.html). We are in the process of depositing the remaining ones to BDSC.

      In conclusion, this is a nicely written manuscript that improves currently available tools and should be of interest to the readership of this journal.

      Reviewer #2 (Recommendations for the authors):

      Typos spotted:

      Line 163 issues -> tissues

      Line 613 significance -> significant

      We thank the reviewer for catching these typos. We have corrected them.

      Reviewer #3 (Recommendations for the authors):

      This is a welcome update to the MAGIC system, which is a brilliant method that has not been as widely adopted as it should be. The authors validate and introduce updates to this system to increase clonal efficiency and more robust labeling (for both pMAGIC and nMAGIC). The data presented are robust and convincing.

      We appreciate the reviewer’s positive comments about our study.

      Suggestions to improve the presentation and adoption of this work:

      (1) The MAGIC system might not be well known, and the manuscript would have benefited from an introductory schematic of how the system works. I realize this was already done in the PLoS Biology paper, but the authors should not assume readers will know that paper, or be willing to look it up. So a standalone schematic, as Figure 1, or something added to Figure 1, would greatly aid in understanding how this system works and what the new updates are doing.

      We thank the reviewer for this kind suggestion. We have added diagrams that explain the principle of MAGIC and the difference between pMAGIC and nMAGIC in Figure 1 - figure supplement 1.

      (2) There were many instances where abbreviations were not clearly defined, especially in the Figures and Figure legends. The main text is well-written, and while the information is in there, it is beneficial when the Figures and Figure legends can stand alone. For example:

      (a) Figure 1. DE, not defined in the Figure or Figure legend.

      (b) Figure 1. 'p' and 'n' not defined in the Figure legend.

      (c) The different Cas9 lines or GAL4 lines used-a brief description of their expression patterns might be helpful in the legend. E.g., zk-Cas9, vas-Cas9, gcm-Cas9, R38F11-GAL4, RabX4Gal4.

      We apologize for omitting the details mentioned. They have been added to the figures and figure legends.

      (3) "Traditional" mosaic analyses took advantage of hsFLP for inducible induction and to control the number of mitotic clones that were induced. A hs-Cas9 line does exist (as correctly pointed out by the authors), and it would be a valuable addition if the authors tested the utility of this reagent with the MAGIC system. Many possible adopters may not like the idea that an alwayson Cas9 line is used, which could result in too many clones, especially if one wanted to label very few cells. Granted, one could use a 'worse' gRNA-Marker line as mentioned in the manuscript, but this might still be hard to titrate, as well as an inducible system that uses a heatshock promoter. A hs promoter is especially useful for birthdating cells during development.

      We thank the reviewer for suggesting this experiment. We agree that demonstrating inducible clone induction in the adult brain is an effective way for people to compare MAGIC with the MARCM method they are probably more familiar with. We used a heat shock Cas9 developed by the Tzumin Lee group (Chen et al., Development, 2020) to experiment with clone induction, and the results are shown in the new Figure 3 (K and J). We show that, with a panneuronal Gal4, heat shock during wandering 3rd instar larval stage induced more clones than during the pupal stage, and the later heat shock readily produced sparsely labeled neurons whose single-cell morphology can be easily visualized.

      (4) Lines 61-63. "However, most of these mutant chromosomes cannot be analyzed by traditional mosaic techniques due to the lack of FRT sites or incompatibility with the FRT/Flp system." It might also be worth mentioning that recombining existing reagents (e.g., mutants, etc) onto an FRT chromosome can be labor and time-intensive. A brilliant advantage of MAGIC is that it can be used with any existing stock, such as from classical EMS mutant screens, Df screens (as pointed out), etc. So the more the authors can emphasize a new way of thinking (e.g, you don't need to recombine your mutant of interest onto an FRT stock before you can get started), the better!

      We thank the reviewer for this kind suggestion. As suggested, we have expanded our introduction and discussion to emphasize the advantages of the MAGIC system over traditional mosaic techniques.

      (5) One incredible advantage of the MAGIC system is that it can direct where recombination occurs. So if one had two mutations on a chromosome arm, it could be possible to make the most distal homozygous mutant while the other remains heterozygous. This is not possible with current FRT-based methods. It's not necessary to demonstrate this, but perhaps the authors could mention it as a possible next step? This was somewhat implied by lines 66-67 "In comparison, MAGIC can potentially be used to study these genes because the crossover site in MAGIC can be flexibly defined by users".

      Again, we thank the reviewer for this nice suggestion. We have added this point to the discussion.

      (6) How stable are the MAGIC lines? If gRNA (with Cas9 expressed) induced a germline mutation of the target site, the MAGIC line would break down. How often is this observed? Some mention of this would be appreciated, especially to end users, if caution is necessary and gRNA-marker stocks should not be maintained in the same flies as an x-Cas9 line.

      The reviewer made a very important point. Keeping gRNA and Cas9 in the same strain will risk mutating the target sequence in the germline, if the Cas9 has any activity in the germline. Thus, it is not recommended to keep gRNA and Cas9 in the same flies over multiple generations. For MAGIC experiments, this concern is lessened because by crossing gRNA + Cas9 flies to another strain containing the chromosome of interest, clones can still be induced (possibly with less efficiency) because the chromosome of interest is still cuttable by Cas9. Nevertheless, to address this concern, we have recently developed anti-CRISPR tools to suppress Cas9 activity in such strains. These tools will be reported in a separate study.

      In the revised manuscript, we added this point in Discussion to caution users.

      (7) Line 157, "identify efficient gRNAs for every chromosomal arm.". What is considered "efficient"? Is this quantifiable? Eg., >= 10 clones.

      Thanks for pointing this out! “Efficient” is an arbitrary evaluation, as different experiments may require different efficiencies. But operationally, we consider any gRNA that can generate >= 10 neuronal clones per larva as being efficient. We have clarified it in the text.

      (8) Line 163, "highly packed _issues_ such as the brain"; spelling, should be "tissues"

      Thanks for catching this typo. It has been corrected.

      (9) The authors use ey-Cas9 for their demonstration of adult brain labeling. Additional adult brain examples would increase exposure of this method and attract wider attention- targeting structures that have been well characterized, such as projection neurons (GH146-GAL4), central complex, mushroom bodies, etc. Especially if hs-Cas9 could be utilized to mimic previous MARCM clones (for example).

      We thank the reviewer for suggesting heat shock-induced clones in the adult brain. We have conducted the experiment as explained above and shown in Figure 3J-3K’. We showed a single neuronal clone that resembles lateral horn Leucokinin neurons.

      (10) Line 216, "Despite these advances, existing mutations on FRT-lacking 4th chromosomes still cannot be analyzed by the FRT/Flp system." For context, it might be worth pointing out that meiotic recombination is exceedingly rare on the 4th chromosome, which means it is practically impossible to recombine existing 4th chromosome mutations onto an FRT chromosome.

      We thank the reviewer for this kind suggestion. We have added a note about the difficulty of recombining FRT onto the 4th chromosome.

      (11) Figure 2 legend. What is the full genotype for D and E? eg, what is RabX4>MApHS?

      We apologize for being brief with the details. RabX4-Gal4 is a pan-neuronal driver. UAS-MApHS is a membrane fluorescent marker (UAS-pHluorin-CD4-tdTom). The genotypes have been added to the figure legend.

      (12) It would be good to include the Bloomington Stock numbers for the MAGIC toolkit, especially in Table 1. And include an HTML reference to their MAGIC page at Bloomington

      (https://bdsc.indiana.edu/stocks/misc/magic.html).

      Thank you for this suggestion! We have done as suggested.

      (13) Similarly, the key plasmids to create the improved gRNA-marker insertions should be deposited to Addgene (or similar repository) and their ID numbers included in the resources table.

      The plasmids have been deposited to Addgene and are currently being validated.

      (14) The authors might consider including (perhaps as supplementary to Figure 1 or Figure 2) a crossing scheme for one of their MAGIC experiments. This will make it even clearer how a MAGIC experiment could be set up using existing fly reagents.

      This is a good suggestion! We have added an example crossing scheme in Figure 1 – figure supplement 1C.

    1. eLife Assessment

      This useful study examines the contribution of synaptotagmin 1 and synaptotagmin 7 to metabolite antigen presentation to mucosal-associated invariant T (MAIT) cells; it begins to address a critical gap in our understanding of the antigen presentation mechanisms of these cells. Strengths of the study include the use of Mtb to study the dynamics of antigen presentation to MAIT cells instead of a synthetic antigen. The strength of the evidence to support the conclusion is solid.

    2. Reviewer #1 (Public review):

      Summary:

      Synaptotagmin (Syt) 1 and Syt7 specifically promote (are critical for) MAIT cell activation in response to M.tb-infected bronchial epithelial cell line BEAS-2B (Fig. 1) and monocyte-like cell line THP-1 (Fig. 3), but not at the M.smeg-infected conditions. Esyt2 shows a similar effect. This work also displayed co-localization of Syt1 and Syt7 with Rab7a and Lamp1, but not with Rab5a (Fig. 5). Loss of Syt1 and Syt7 resulted in a larger area of MR1 vesicles (Fig. 6f) and an increased number of MR1 vesicles in close proximity to an Auxotrophic Mtb-containing vacuoles during infection (Fig. 7ab). Moreover, flow organellometry to separate phagosomes from other subcellular fractions and identify enrichment of auxotrophic Mtb-containing vacuoles in fractions 42-50, which were enriched with Lamp1+ vacuoles or phagosomes (Fig.7e-f).

      Strengths:

      This work convincingly associated Syt1 and Syt7 with late endocytic compartments and Mtb+ vacuoles. Gene editing of Syt1 and Syt7 loci of bronchial epithelial and monocyte-like cells supported Syt1 and Syt7 facilitated maintaining a normal level of antigen presentation for MAIT cell activation in Mtb infection. Imaging analyses provided solid evidence to support that Syt1 and Syt7 mutants enhanced the size of MR1-resided vesicles, the overlaps of MR1 with M.tb fluorescent signal, and the MR1 proximity with Mtb-infected vacuoles, suggesting that Syt1 and Syt7 proteins help antigen presentation for MAIT activation in Mtb infection.

      Weaknesses:

      Current data could be improved to support the conclusion that "This study identifies a pathway in which Syt1 and Syt7 facilitate the translocation of MR1 from Mtb-containing vacuoles, potentially to the cell surface for antigen presentation". Likewise, the current data are more supportive of a different conclusion.

      Comments on revisions:

      Authors have been very responsive to the review comments, except for keeping a very strong conclusion. Suggest rewriting the conclusions "identifies a specialized pathway", "facilitate the translocation", "from Mtb-containing vacuoles", and "potentially to the cell surface" to be more reflective of the data.

    3. Reviewer #3 (Public review):

      Summary:

      In the submitted manuscript the authors investigate the role of Synaptotagmins (Syt1) and (Syt7) in MR1 presentation of Mtb antigens. By using Syt1 and Syt7 knock down the authors determine that these molecules are required to effectively control Mtb infection.

      Strengths:

      In the first series of experiments, the authors determined that knocking down Syt1 and Sy7 in antigen-presenting cells decreases IFN-γ production following cellular infection with Mtb. These experiments are well performed and controlled.

      Comments on revisions:

      The revised manuscript offers further support to the role of Synaptogamins 1 and 7 in MR1 trafficking during MT infection

    4. Author response:

      The following is the authors’ response to the original reviews.

      Public Reviews:

      Reviewer #1 (Public review):

      Summary:

      The manuscript "Synaptotagmin 1 and Synaptotagmin 7 promote MR1-mediated presentation of Mycobacterium tuberculosis antigens", authored by Kim et al., showed that the calcium-sensing trafficking proteins Synaptotagmin (Syt) 1 and Syt7 specifically promote (are critical for) MAIT cell activation in response to Mtb-infected bronchial epithelial cell line BEAS-2B (Fig. 1) and monocyte-like cell line THP-1 (Figure 3) . This work also showed co-localization of Syt1 and Syt7 with Rab7a and Lamp1, but not with Rab5a (Figure 5). Loss of Syt1 and Syt7 resulted in a larger area of MR1 vesicles (Figure 6f) and an increased number of MR1 vesicles in close proximity to an Auxotrophic Mtb-containing vacuoles during infection (Figure 7ab). Moreover, flow organellometry was used to separate phagosomes from other subcellular fractions and identify enrichment of auxotrophic Mtb-containing vacuoles in fractions 42-50, which were enriched with Lamp1+ vacuoles or phagosomes (Figures 7e-f).

      Strengths:

      This work nicely associated Syt1 and Syt7 with late endocytic compartments and Mtb+ vacuoles. Gene editing of Syt1 and Syt7 loci of bronchial epithelial and monocyte-like cells supported Syt1 and Syt7 facilitated maintaining a normal level of antigen presentation for MAIT cell activation in Mtb infection. Imaging analyses further supported that Syt1 and Syt7 mutants enhanced the overlaps of MR1 with Mtb fluorescence, and the MR1 proximity with Mtb-infected vacuoles, suggesting that Syt1 and Syt7 proteins help antigen presentation in Mtb infection for MAIT activation.

      Weaknesses:

      Additional data are needed to support the conclusion, "identify a novel pathway in which Syt1 and Syt7 facilitate the translocation of MR1 from Mtb-containing vacuoles" and some pieces of other evidence may be seen by some to contradict this conclusion.

      We thank the reviewer for their positive and constructive comments. Because MR1 presents small molecule metabolites, specifically identifying MR1 molecules loaded with antigens derived from intracellular Mtb infection remains a significant technical challenge. Therefore, we agree that some of our approaches measure antigen-loaded MR1 indirectly. For example, IFN-γ release from a MAIT cell clone serves as a sensitive surrogate readout for the presence of antigen-loaded MR1 at the cell surface. This has been demonstrated in previous work showing that IFN-γ release from MAIT cells correlated with loaded MR1 molecules measured using flow cytometry and a TCR based tetramer (Kulicke et al., 2024). In this context, Syt1 and Syt7 represent the first endosomal trafficking proteins we have identified that play a specific role in MR1-mediated presentation of Mtb-derived metabolites. Syt1 and Syt7 do not contribute to the presentation of an exogenously delivered MR1 ligands, such as Ac-6-FP loaded in the ER or M. smegmatis supernatant. In Syt1 and Syt7 knockout cells expressing MR1-GFP, larger MR1 vesicles are observed, but MR1 continues to co-localize with LAMP1 similar to wildtype cells. Furthermore, Syt1 and Syt7 knockout cells exhibit an increased number of MR1 vesicles near the Mtb-containing vacuoles compared to wildtype cells. To increase the statistical power of our microscopy analyses, we have analyzed additional cells. Although the absolute magnitude of the observed effects is modest, T cell activation is highly sensitive to the number of loaded antigen presenting molecules at the cell surface. Also, a complementary approach using flow organellometry confirmed increased MR1 expression within Mtb<sup>+</sup>LAMP1<sup>+</sup> vesicles in Syt7 knockout cells. Thus, these findings suggest a mechanism whereby Syt1 and Syt7 facilitate the trafficking of loaded MR1 molecules from the Mtb-containing vacuoles to the plasma membrane. This specialized mechanism may be analogous to the previously described role of Syt7 in MHC class II trafficking (Becker et al., 2009). In our model, we observed increased accumulation and expression of MR1 within Mtb-containing vacuoles in Syt7 knockout cells.

      Reviewer #2 (Public review):

      Summary:

      The study demonstrates that calcium-sensing trafficking proteins Synaptotagmin (Syt) 1 and Syt7 are involved in the efficient presentation of mycobacterial antigens by MR1 during M. tuberculosis infection. This is achieved by creating antigen-presenting cells in which the Syt1 and Syt7 genes are knocked out. These mutated cell lines show significantly reduced stimulation of MAIT cells, while their stimulation of HLA class I-restricted T cells remains unchanged. Syt1 and Syt7 co-localize in a late endo-lysosomal compartment where MR1 molecules are also located, near M. tuberculosis-containing vacuoles.

      Strengths:

      This work uncovers a new aspect of how mycobacterial antigens generated during infection are presented. The finding that Syt1 and Syt7 are relevant for final MR1 surface expression and presentation to MR1-restricted T cells is novel and adds valuable information to this process. The experiments include all necessary controls and convincingly validate the role of Syt1 and Syt7. Another key point is that these proteins are essential during infection, but they are not significant when an exogenous synthetic antigen is used in the experiments. This emphasizes the importance of studying infection as a physiological context for antigen presentation to MAIT cells. An additional relevant aspect is that the study reveals the existence of different MR1 antigen presentation pathways, which differ from the endoplasmic reticulum or endosomal pathways that are typical for MHC-presented peptides.

      Weaknesses:

      The reduced MAIT cell response observed with Syt1 and Syt7-deficient cell lines is statistically significant but not completely abolished. This may suggest that only some MR1-loaded molecules depend on these two Syt proteins. Further research is needed to determine whether, during persistent M. tuberculosis infection, enough MR1-loaded molecules are produced and transported to the plasma membrane to sufficiently stimulate MAIT cells. The study proposes that other Syt proteins might also play a role, as outlined by the authors. However, exploring potential redundant mechanisms that facilitate MR1 loading with antigens remains a challenging task.

      We appreciate the reviewer’s comments and feedback. Syt1 and Syt7 knockout cells do not completely abolish MR1-mediated presentation of Mtb-derived metabolites. We agree that the likely explanation is that there are redundancies within the antigen presentation pathways. Whether these redundancies are due to other endosomal trafficking proteins or other intracellular compartments where MR1 loading can occur remains unknown. Moreover, Mtb-derived antigens can access the ER, where Syt1 and Syt7 are not involved, thereby enabling an ER-mediated pathway for MR1 antigen presentation. It is also important to note that relatively few (<10) loaded MHC class I molecules are sufficient to trigger T cell activation (Brower et al., 1994; Sykulev et al., 1995; Sykulev et al., 1996). A major challenge in exploring these mechanisms is due to the inability to directly track small molecule Mtb-derived antigens as they are loaded onto MR1 and presented at the cell surface. These hurdles are briefly outlined in the discussion as future directions. Nonetheless, Syt1 and Syt7 are the first endosomal trafficking proteins identified to have a specific effect on MR1-mediated presentation of Mtb-derived antigens.

      Reviewer #3 (Public review):

      Summary:

      In the submitted manuscript, the authors investigate the role of Synaptotagmins (Syt1) and (Syt7) in MR1 presentation of MtB.

      Strengths:

      In the first series of experiments, the authors determined that knocking down Syt1 and Sy7 in antigenpresenting cells decreases IFN-γ production following cellular infection with Mtb. These experiments are well performed and controlled.

      Weaknesses:

      Next, they aim to mechanistically investigate how Syt1 and Syt7 affect MtB presentation. In particular, they focus on MR1, a non-classical MHC-I molecule known to present endogenous and exogenous metabolites, including MtB metabolites. Results from these next series of experiments are less clear. Firstly, they show that knocking down Syt1 and Sy7 does not change MtB phagocytosis as well as MR1 ER-plasma membrane translocation. Based on this, they suggest that Syt1 and Syt7 may affect MR1 trafficking in endosomal compartments. However, neither subcellular compartment analysis nor flow organelleometry clearly establishes the role of Syt1 and Syt7 in MtB trafficking. Altogether, the notion that Synaptotagmins facilitate MR1 interaction with Mtb-containing compartments and its vesicular transport was already known. As such, the manuscript should add additional insight on where/how the interaction occurs. The reviewer is left with the notion that Syt1 and Sy7 may affect MR1 presentation, facilitating the trafficking of MR1 vesicles from endosomal compartments to either the cell surface or other endosomal compartments. The analysis is observational and additional data or discussion could address what the insight gained beyond what is already known from the literature.

      We thank Reviewer 3 for their comments. Our hypothesis is that Syt1 and Syt7 mediate MR1 trafficking rather than Mtb trafficking. While Syt7 has previously been implicated in MHC class II trafficking and vesicular transport, this study is the first to explore in detail the roles of Syt1 and Syt7 in MR1-mediated presentation of Mtb-derived metabolites. Since current technologies do not allow direct tracking of Mtbderived antigens loaded onto MR1, we relied on complementary approaches including IFN-γ release from MAIT cells, flow cytometry, fluorescence microscopy, and flow organelleometry. Both flow organelleometry and fluorescence microscopy show increased MR1 expression at Mtb-containing vacuoles in Syt7 knockout cells. Since total MR1 expression measured by flow cytometry and the overall number of MR1 vesicles remain unchanged, these data support a mechanism in which Syt7 facilitates the trafficking of antigen-loaded MR1 from Mtb-containing vacuoles to the cell surface, consistent with the observed reduction in MAIT cell IFN-γ release.

      Recommendations for the authors:

      Reviewer #1 (Recommendations for the authors):

      Concern 1, the data in the current manuscript have not been sufficient to "identify a novel pathway in which Syt1 and Syt7 facilitate the translocation of MR1 from Mtb-containing vacuoles, potentially to the cell surface for antigen presentation" (Last part of Abstract). To conclude this, additional pieces of data are needed: (a) Mtb-containing vacuoles associate with MR1 protein expression; (b) MR1+ vesicles traffic from one subcellular location to another; (c) Syt1 or Syt7 KO reduces MR1 vesicles at a downstream subcellular location, e.g., the cell surface. Important evidence supporting the "facilitation of translocation" is missing on whether Syt1 or Syt7 KO reduces MR1 vesicle traffic from one location to another.

      We thank the reviewer for their detailed suggestions to improve our proposed model. We would like to clarify that Figure 7g demonstrates increased MR1 protein expression in Syt7 knockout cells, as assessed by flow organellometry. This approach allowed us to specifically distinguish AuxMtb<sup>+</sup>LAMP1<sup>+</sup> compartments (Mtb-containing vacuoles) and to quantify MR1 expression using geometric mean fluorescence intensity. Moreover, in both Syt1 and Syt7 knockout cells, MR1+ vesicles are retained within lysosomal compartments, characterized by vesicle enlargement and accumulation. Therefore, we did not observe trafficking of MR1+ vesicles to other subcellular locations or to the plasma membrane. A key limitation, however, is the lack of current technologies that allow direct measurement of MR1 surface expression specifically during intracellular Mtb infection via flow cytometry. Given this limitation, IFN-γ ELISpot is a sensitive surrogate and supports the conclusion that loss of Syt1 and Syt7 results in decreased MR1 presentation of Mtb-derived antigens at the plasma membrane.

      The results "a significant increase in the number of MR1 vesicles within 1 μm of AuxMtb for Syt1 (1.13 {plus minus} 0.46) and Syt7 KO (1.31 {plus minus} 0.46) cells compared to WT cells (Fig.7b)." and "the surface of MR1 vesicles in Syt1 and Syt7 KO cells showed a 3-fold increase in overlap area with Mtb surfaces (Fig.7d)." may need to be further elaborated on whether MR1+vacuoles and Mtb+ vacuoles are overlapped or are adjacent. Figure 7b shows several groups of vacuoles with the same distance. This needs a larger sample size to randomize this distance measurement, for example, calculating 50~100 Mtb+ vacuoles.

      We appreciate the reviewer’s critical comments and suggestions. To quantify distance and surface overlap, the microscopy images were acquired from a single optical plane rather than full z-stacks. As a result, it is not possible to definitively determine whether MR1+ vesicles and Mtb-containing vacuoles are directly overlapping or adjacent. In response to the reviewer’s suggestion, we increased the sample size for both distance (n=51-53) and surface overlap analyses (n=51-53). Using the larger sample size, we observed a significant increase in the number of MR1 vesicles located within 1μm of AuxMtb in both Syt1 (1.23±0.21) and Syt7 knockout (1.28±0.22) cells. Also, there was an approximately 4-fold increase in MR1-Mtb surface overlap area compared to wildtype cells.

      Results from "performed flow organellometry to separate phagosomes from other subcellular fractions and identified enrichment of Mtb-containing vacuoles in fractions 42-50 (Fig.7e-f)" could not distinguish the difference between WT and Syt1/Syt7 KO, or further support the role of Syt1/Syt7 in endocytic trafficking. More specifically, authors claimed that "enhanced MR1 expression in Mtb+LAMP1+ compartments via flow organellometry in Syt1 and Syt7 KO cells.", may not be supported by Figure 7f, which does not show a difference in MR1 expression between Syt1 KO or Syt7 KO and WT.

      We appreciate the reviewer’s concerns and would like to clarify the interpretation of Figures 7f and 7g. Figure 7f demonstrates: (a) enrichment Mtb-containing vacuoles within fractions 42-50, (b) coenrichment of LAMP1+ vesicles within these Mtb-containing fractions, and (c) comparable subcellular fractionation profiles across wildtype, Syt1 knockout, and Syt7 knockout cells, indicating no major differences in fraction distribution. Differences in MR1 expression are shown in Figure 7g, which compares MR1 expression as the geometric mean fluorescence intensity within the fraction exhibiting the highest percentage of AuxMtb<sup>+</sup>LAMP1<sup>+</sup> across all fractions. We observed significant increase in MR1 expression in Syt7 knockout cells compared to wildtype cells.

      Concern 2, in abstract, "Loss of Syt1 and Syt7 results in enlarged MR1 vesicles and an increased number of MR1 vesicles in close proximity to Mtb-containing vacuoles during infection.". Although numbers of MR1 vesicles within 1um of Mtb increase (Figure 7b) and areas of MR1+ vacuoles for WT and KO cells enhance (Figure 6f), but numbers of MR1 vesicles/cells are not different between WT and Syt1 and Sy7 KO (Fig. 7c). These imaging analyses, including other figure panels, need more explicit presentation of (most if not all) random images for calculation, annotation of MR1-vacuoles for calculation, and raw statistical data for mean and p value calculation. These raw data can be presented in supplemental figure panels.

      We thank the reviewer for these suggestions. We have included more details on randomization, technical procedures, and statistical analyses in methods section for “Fluorescence Microscopy,” “Image Analysis,” and “Statistical Analysis.” Raw data collection and statistical data are presented in the supplemental data.

      Concern 3, additional evidence that does not support the conclusion "This study identifies a novel pathway in which Syt1 and Syt7 facilitate the translocation of MR1 from Mtb-containing vacuoles" (the last part of Abstract). This additional unsupportive evidence includes: (a) MR1 expression on the cell surface is not impacted or not different among WT, Syt1 KO, and Syt7 KO of BEAS-2B cells (Fig. 6d). (b) "Live-cell imaging showed no differences in MR1 cellular distribution in the presence or absence of Ac-6FP between WT, Syt1, and Syt7 KO BEAS-2B:TET-MR1GFP cells as MR1 translocated from the ER and vesicles to the cell surface as expected (Figure 6c).

      We thank the reviewer for this comment and would like to clarify our use of Ac-6-FP. Figures 6c and 6d examine MR1 cellular distribution and surface expression in the presence or absence of Ac-6-FP. Ac-6-FP is a small MR1 ligand that is loaded in the ER and promotes MR1 surface stabilization and trafficking to the cell membrane. In contrast, Mtb primarily resides within membrane-bound phagosomes. MR1 presentations of soluble/exogenously delivered ligands versus intracellular Mtb-derived antigens have shown to involve distinct pathways and endosomal trafficking proteins (Harriff et al., 2016; Karamooz et al., 2019; Karamooz et al., 2025). Findings from Figures 6c and 6d show that Syt1 and Syt7 do not contribute to the presentation of small soluble and ER-loaded ligands such as Ac-6-FP. Instead, they specifically contribute in MR1 presentation of Mtb-derived metabolites by translocating MR1 from Mtbcontaining vacuoles in the context of intracellular Mtb infection

      Other concerns:

      (1) Figure 1a uses Ct value to measure Syt1 and Syt7 expression levels, but a comparison with GAPDH Ct cycle numbers in different cell types will be helpful for understanding.

      We appreciate the reviewer’s suggestion of including GADPH Ct cycle numbers. We have revised Figure 1a to show Ct values for Syt1, Syt7, and GAPDH in both BEAS-2B and THP-1 cells.

      (2) Figure 1b indel, shown with an ICE method, should be confirmed with protein expression levels to interpret functional results.

      We thank the reviewer for raising this concern. We attempted to assess protein levels by western blot using multiple antibodies from both Abcam and Synaptic Systems. However, we were unable to identify a suitable antibody that reliably detected endogenous Syt1 or Syt7 protein levels.

      (3) Figure 1c. HLA-B45-restricted T cell clones also show some marginal reduction of IFN-γ spot responses and are more different in Figure 6b. Please discuss this conflicting data. Also, need a reference to support whether the exogenous CFP peptide antigen is presented via surface or endocytic antigen loading.

      We agree with the reviewer that there are some marginal reductions of IFN-γ responses for HLA-B45restricted T cell clones. Since T cell clones are used from frozen, there can be differences in maximal responses between T cell clones and expansions of the same T cell clone. However, the comparisons include a control arm and pool data from multiple experiments to reach statistical power and validity. In addition, Figure 6b shows Syt1 and Syt7 KO cells in the background of BEAS-2B MR1KO:tetMR1-GFP clone D4 cells, which overexpresses MR1 that may contribute to variability and potentially account for the observed differences. With respect to exogenous CFP peptide loading, earlier studies on peptides and antigen presenting cells demonstrated that peptides can be loaded onto fixed cells and subsequently presented to T cells (Shimonkevitz et al., 1983; Watts et al., 1985). Based on these findings, it is reasonable to assume that substantial peptide exchange occurs at the cell surface when exogenous peptides are added to antigen presenting cells.

      (4) Figure 2e: Delta CT values of Syt1, Syt7 in WT, KO cells can be shown together with Ct values of GAPDH or B2m house-keeping genes to help readers determine the efficiency of Syt1 and 7 mutation at the gene expression level. Also, in Figure 4a, the baseline of Ct values for GAPDH can be plotted together.

      As suggested by the reviewer, we have revised Figure 2e and 4a to include CT values for the genes of interest as well as housekeeping gene GAPDH.

      (5) Figure 3c and Figure 1d: M.smeg infection can be shown to be more comparable with Mtb infection.

      We thank the reviewer for this thoughtful comment. Although M. smegmatis infection could serve as a comparable control, M. smegmatis secretes large amounts of MR1 ligands derived from riboflavin metabolism. This makes it difficult to distinguish between extracellular and intracellular antigens, and to directly compare with Mtb infection, which is specifically an intracellular infection model.

      (6) Figure 4e: It appears Esyt2 Knockdown shows strong inhibition of MAIT activation mediated by BEAS2B cells with Mtb infection and M.smeg supernatant stimulation. Please add other relevant data, such as MR1 cell surface expression and colocalization, and discuss these results with Syt proteins.

      We appreciate the reviewer’s suggestion to include relevant data for Esyt2 knockdown. We performed flow cytometry analysis of Esyt2 knockdown cells and found surface MR1 expression under basal conditions. Treatment with Ac-6-FP resulted in increased MR1 surface stabilization, but MR1 surface level was significantly lower than those observed in missense control cells. Therefore, Esyt2 is not specific to MR1 presentation of Mtb-derived metabolites and instead may play a broader role in overall MR1 antigen presentation, including intracellular Mtb-derived antigens, exogenous antigens, and ER-loaded Ac-6-FP.

      (7) Figure 5 colocalization computational analyses can be more explicitly presented regarding randomization, technical procedures, and statistical analyses, as stated in Concern 2.

      As suggested, we have included more details in methods section and added the supplemental data.

      (8) Figure 6a: Syt1 and Syt7 protein expressions are also suggested to confirm the mutation, similar to the confirmation for Figures 1 and 3.

      We thank the reviewer for raising this concern. As discussed previously, we have not identified a suitable antibody for human Syt1 and Syt7. We have tested multiple antibodies from Abcam and Synaptic Systems.

      (9) For statistical analyses, "non-linear regression analysis comparing best-fit values of top and EC50 were used to calculate p-values by extra sum-of-squares F test" (Figure 6b) and "non-linear regression analysis of pairwise comparison to WT on best-fit values of top and EC50 were used to calculate p-values by extra sum-of-squares F test." (Figure 3bc), readers may need more specific demonstration in supplemental figures on how statistical analyses have been performed.

      We appreciate the reviewer’s suggestion to include more detailed information regarding the statistical analyses. For clarification, data presented in Figures 6b and 3bc were analyzed using the same statistical analysis in Prism 10. Specifically, nonlinear regression (curve fit) was performed using the [Agonist] vs. response model with three parameters. Best-fit values for the top and EC<sub>50</sub> parameters were compared using an extra sum-of-squares F test.No constraints were applied to the bottom and top parameters, and the EC<sub>50</sub> parameter was constrained to be greater than 0 for p-value calculation. We have revised the Statistical Analysis section of the Methods to more clearly describe this approach.

      (10) In discussion, the background section for Syt1 and Syt7 is more appropriate to be in the introduction. This will allow readers to better understand the association of Syt proteins with MR1 and the necessity to study the impact of Syt on MR1 trafficking.

      We thank the reviewer for this suggestion. We believe that the basic background and relevance of Syt1 and Syt7 in MR1 trafficking are covered in the introduction; however, we have added details to help readers understand their impact.

      Reviewer #2 (Recommendations for the authors):

      This reviewer has no requests for implementation and congratulates the authors on this nice piece of work.

      We thank the reviewer for the positive comments.

      Reviewer #3 (Recommendations for the authors):

      Complete trafficking experiments to pinpoint the trafficking relationship between Syt 1 and 7 and MR1 in MtB infection.

      We appreciate the reviewer’s insightful comment. As this study represents the first detailed investigation into the roles of Syt1 and Syt7 in MR1-mediated presentation of Mtb-derived metabolites, we agree that a fully resolved trafficking mechanism has not yet been established. A major limitation is the inability to directly track Mtb-derived antigens as they are loaded onto MR1 and trafficked to the cell surface. Therefore, we relied on complementary functional and microscopy-based approaches, including IFN-γ ELISpot assays, flow cytometry, fluorescence microscopy, and flow organellometry, to infer the trafficking relationships between Syt1, Syt7, and MR1 during intracellular Mtb infection. Our data support a model that Syt1 and Syt7 facilitates the trafficking of MR1 from Mtb-containing vacuoles to the plasma membrane. This interpretation is supported with the increased accumulation of MR1 in Mtb-containing vacuoles and reduction in MAIT cell IFN-γ release observed in Syt1 and Syt7 knockout cells.

      References

      (1) Becker, S. M., Delamarre, L., Mellman, I., & Andrews, N. W. (2009). Differential role of the Ca(2+) sensor synaptotagmin VII in macrophages and dendritic cells. Immunobiology, 214(7), 495–505.

      (2) Brower, R. C., England, R., Takeshita, T., Kozlowski, S., Margulies, D. H., Berzofsky, J. A., & Delisi, C. (1994). Minimal requirements for peptide-mediated activation of CD8+ CTL. Molecular immunology, 31(16), 1285–1293.

      (3) Harriff, M. J., Karamooz, E., Burr, A., Grant, W. F., Canfield, E. T., Sorensen, M. L., Moita, L. F., & Lewinsohn, D. M. (2016). Endosomal MR1 Trafficking Plays a Key Role in Presentation of Mycobacterium tuberculosis Ligands to MAIT Cells. PLoS pathogens, 12(3), e1005524.

      (4) Karamooz, E., Harriff, M. J., Narayanan, G. A., Worley, A., & Lewinsohn, D. M. (2019). MR1 recycling and blockade of endosomal trafficking reveal distinguishable antigen presentation pathways between Mycobacterium tuberculosis infection and exogenously delivered antigens. Scientific reports, 9(1), 4797.

      (5) Karamooz, E., Kim, S. J., Peterson, J. C., Tammen, A. E., Soma, S., Soll, A. C. R., Meermeier, E. W., Khuzwayo, S., & Lewinsohn, D. M. (2025). Two-pore channels in MR1-dependent presentation of Mycobacterium tuberculosis infection. PLoS pathogens, 21(8), e1013342.

      (6) Kulicke, C. A., Swarbrick, G. M., Ladd, N. A., Cansler, M., Null, M., Worley, A., Lemon, C., Ahmed, T., Bennett, J., Lust, T. N., Heisler, C. M., Huber, M. E., Krawic, J. R., Ankley, L. M., McBride, S. K., Tafesse, F. G., Olive, A. J., Hildebrand, W. H., Lewinsohn, D. A., Adams, E. J., … Harriff, M. J. (2024). Delivery of loaded MR1 monomer results in efficient ligand exchange to host MR1 and subsequent MR1T cell activation. Communications biology, 7(1), 228.

      (7) Shimonkevitz, R., Kappler, J., Marrack, P., & Grey, H. (1983). Antigen recognition by H-2restricted T cells. I. Cell-free antigen processing. The Journal of Experimental Medicine, 158(2), 303–316.

      (8) Sykulev, Y., Cohen, R. J., & Eisen, H. N. (1995). The law of mass action governs antigen-stimulated cytolytic activity of CD8+ cytotoxic T lymphocytes. Proceedings of the National Academy of Sciences of the United States of America, 92(26), 11990–11992.

      (9) Sykulev, Y., Joo, M., Vturina, I., Tsomides, T. J., & Eisen, H. N. (1996). Evidence that a single peptide-MHC complex on a target cell can elicit a cytolytic T cell response. Immunity, 4(6), 565– 571.

      (10) Watts, T. H., Gariépy, J., Schoolnik, G. K., & McConnell, H. M. (1985). T-cell activation by peptide antigen: effect of peptide sequence and method of antigen presentation. Proceedings of the National Academy of Sciences of the United States of America, 82(16), 5480–5484.

    1. eLife Assessment

      The important study uses genome-wide CRISPR/Cas9 screenings to identify a novel target B4GALTZ1 that is implicated in modulating CD8+ T cell function in the context of anti-tumor immunity. The strength of evidence is solid but could benefit from more detail, particularly to verify the efficiency of knockout in their single gene KO lines and identification of N-glycosylation sites of TCR and CD8s. This work highlights the role of protein N-glycosylation, particularly B4GALT1 deficiency, in regulating CD8 function and anti-tumor immunity.

    2. Reviewer #1 (Public review):

      Summary:

      The study by Yu et al investigated the role of protein N-glycosylation in regulating T-cell activation and functions is an interesting work. By using genome-wide CRISPR/Cas9 screenings, authors found that B4GALT1 deficiency could activate expression of PD-1 and enhance functions of CD8+ T cells both in vitro and in vivo, suggesting the important roles of protein N-glycosylation in regulating functions of CD8+ T cells, which indicates that B4GALT1 is a potential target for tumor immunotherapy.

      Strengths:

      The strengths of this study are the findings of novel function of B4GALT1 deficiency in CD8 T cells.

      Weaknesses:

      Although authors have partly addressed my questions, including potential mechanism, however, I found that the impact of B4GALT1 deficiency for T cell function against tumor cells was not very striking, in comparing to other recently identified genes, which may limit its application, such as in adoptive T cell therapy.

      Comments on revisions:

      Authors have addressed the questions raised in previous review.

    3. Reviewer #2 (Public review):

      Summary:

      In this study, the authors identify the N-glycosylation factor B4GALT1 as an important regulator of CD8 T-cell function.

      Strengths:

      The use of complementary ex vivo and in vivo CRISPR screens is commendable and provides a useful dataset for future studies of CD8 T-cell biology.

      The authors perform multiple untargeted analyses (RNAseq, glycoproteomics) to hone their model on how B4GALT1 functions in CD8 T-cell activation, as well as the use of a CD8-CD3 to narrow down the effects of B4GALT1, which is a broad-acting enzyme.

      B4GALT1 is shown to be important in both in vitro T-cell killing assays and a mouse model of tumor control, reinforcing the authors' claims.

      Weaknesses:

      The authors did not verify the efficiency of knockout in their single gene KO lines, although they mention a plan to include such data in a future version of the manuscript.

      The specific N-glycosylation sites of TCR and CD8 are not identified, and would be helpful for site-specific mutational analysis to further the authors' model.

      The study or future studies could benefit from further in vivo experiments testing the role of B4GALT1 other physiological contexts relevant to CD8 T cells, for example autoimmune disease or infectious disease.

      Comments on revisions:

      The paper improved after revision.

    4. Author response:

      The following is the authors’ response to the original reviews.

      eLife Assessment

      This valuable work investigates the role of protein N-glycosylation in regulating T-cell activation and function and suggests that B4GALT1 is a potential target for tumor immunotherapy. The strength of evidence is solid, and further mechanistic validation could be provided.

      We sincerely thank the editor and reviewers for their time and constructive feedback. Your recognition of our work is much appreciated. We clarify our mechanistic studies as stated below.

      Public Reviews:

      Reviewer #1 (Public review):

      Summary:

      The study by Yu et al investigated the role of protein N-glycosylation in regulating T-cell activation and functions is an interesting work. By using genome-wide CRISPR/Cas9 screenings, the authors found that B4GALT1 deficiency could activate expression of PD-1 and enhance functions of CD8+ T cells both in vitro and in vivo, suggesting the important roles of protein N-glycosylation in regulating functions of CD8+ T cells, which indicates that B4GALT1 is a potential target for tumor immunotherapy.

      Strengths:

      The strengths of this study are the findings of novel function of B4GALT1 deficiency in CD8 T cells.

      Weaknesses:

      However, authors did not directly demonstrate that B4GALT1 deficiency regulates the interaction between TCR and CD8, as well as functional outcomes of this interaction, such as TCR signaling enhancements.

      We are very sorry that we did not highlight our results in Fig. 5f-h enough. In those figures, we demonstrated the interaction between TCR and CD8 increased significantly in B4GALT1 deficient T-cells, by FRET assays. To confirm the important role of TCR-CD8 interaction in mediating the functions of B4GALT1 in regulating T-cell functions, such as in vitro killing of target cells, we artificially tethered TCR and CD8 by a CD8β-CD3ε fusion protein and tested its functions in both WT and B4GALT1 knockout CD8<sup>+</sup> T-cell. Our results demonstrate that such fusion protein could bypass the effect of B4GALT1 knockout in CD8<sup>+</sup> T-cells (Fig. 5g-h). Together with the results that B4GALT1 directly regulates the galactosylation of TCR and CD8, those results strongly support the model that B4GALT1 modulates T-cell functions mainly by galactosylations of TCR and CD8 that interfere their interaction.

      Reviewer #2 (Public review):

      Summary:

      In this study, the authors identify the N-glycosylation factor B4GALT1 as an important regulator of CD8 T-cell function.

      Strengths:

      (1) The use of complementary ex vivo and in vivo CRISPR screens is commendable and provides a useful dataset for future studies of CD8 T-cell biology.

      (2) The authors perform multiple untargeted analyses (RNAseq, glycoproteomics) to hone their model on how B4GALT1 functions in CD8 T-cell activation.

      (3) B4GALT1 is shown to be important in both in vitro T-cell killing assays and a mouse model of tumor control, reinforcing the authors' claims.

      Weaknesses:

      (1) The authors did not verify the efficiency of knockout in their single-gene KO lines.

      Thank reviewer for reminding. We verified the efficiency of some gRNAs by T7E1 assay. We will add those data in supplementary results in revised version later.

      (2) As B4GALT1 is a general N-glycosylation factor, the phenotypes the authors observe could formally be attributable to indirect effects on glycosylation of other proteins.

      Please see response to reviewer #1.

      (3) The specific N-glycosylation sites of TCR and CD8 are not identified, and would be helpful for site-specific mutational analysis to further the authors' model.

      Thank reviewer for suggestion! Unfortunately, there are multiple-sites of TCR and CD8 involved in N-glycosylation (https://glycosmos.org/glycomeatlas). We worry that mutations of all these sites may not only affect glycosylation of TCR and CD8 but also other essential functions of those proteins.

      (4) The study could benefit from further in vivo experiments testing the role of B4GALT1 in other physiological contexts relevant to CD8 T cells, for example, autoimmune disease or infectious disease.

      Thank reviewer for this great suggestion to expand the roles of B4GALT1 in autoimmune and infection diseases. However, since in current manuscript we are mainly focusing on tumor immunology, we think we should leave these studies for future works.

      Recommendations for the authors:

      Reviewer #1 (Recommendations for the authors):

      The study by Yu et al investigated the role of protein N-glycosylation in regulating T-cell activation and functions is an interesting work. By using genome-wide CRISPR/Cas9 screenings, the authors found that B4GALT1 deficiency could activate expression of PD-1 and enhance functions of CD8+ T cells both in vitro and in vivo, suggesting the important roles of protein N-glycosylation in regulating functions of CD8+ T cells, which indicates that B4GALT1 is a potential target for tumor immunotherapy. However, authors need to directly demonstrate that B4GALT1 deficiency regulates the interaction between TCR and CD8, as well as functional outcomes of this interaction, such as TCR signaling enhancements. In addition, blocking PD1 has been shown to enhance antitumor effect, whereas the presented data in this study suggest that the activation of PD1 expression in the condition of B4GALT1 deficiency in T cells enhanced antitumor effect. How to reconcile this discrepancy? Finally, several minor questions need to be addressed to strengthen the conclusions in this manuscript.

      (1) We used a FRET (Fluorescence Resonance Energy Transfer) assay to measure interaction between TCR and CD8. FRET signals of TCR-CD8 increased significantly in B4GALT1 deficient T-cells, compared with control cells (Fig. 5f). For functional outcomes of this interaction, we observed enhanced T-cell killing activities in B4GALT1 deficient CD8<sup>+</sup> T-cells (Fig. 3f and Fig. 5h).

      To confirm whether reduced TCR-CD8 interaction is the major cause of TCR activation phenotypes in B4GALT1 knockout CD8<sup>+</sup> T-cells, we generated a construct in which we fused the CD8b ectodomain (ECD) with CD3e to artificially tether TCR with CD8 (Fig.5g). Overexpression of such CD8β-CD3ε fusion led to enhanced in vitro killing activities in control wild-type CD8<sup>+</sup> T-cells. On the other hand, in B4GALT1 deficient CD8<sup>+</sup>T-cells, such enhanced T-cell killing activities by fusion construct was significantly diminished (Fig.5h), suggesting it bypassed the regulation by B4GALT1.

      (2) PD-1 is both an early T-cell activation marker upon TCR activation and a T-exhausted marker under consecutive or repeated stimulations. In our screenings, PD-1 was used as an early activation marker for T-cells.

      We have clarified this in new Discussion section.

      (1) The present data relies on statistical graphs (e.g., bar and line charts) for all data, excluding the bioinformatics analysis. Including data such as flow cytometry plots, photomicrographs, or immunohistochemistry staining images will provide more direct support for the conclusions.

      Thank the reviewer for valuable suggestions! We added original flow cytometry gating strategies for Cas9 screening sorting (Fig. S1a), TIL analysis (Fig.S5), and FRET assay (Fig. S8) in revised version to provide more direct support for our conclusions.

      (2) To further validate the enhanced tumor infiltration phenotype resulting from B4GALT1 knockout, the following data would strengthen the manuscript:

      (a) Flow cytometric analysis of TILs or immunofluorescence data from tumor sections.

      Thank the reviewer for valuable suggestion! We added original flow cytometry gating strategies for TILs in Fig. S5 in revised version.

      (b) Assessment of in vivo T cell proliferation, for example, by tracking changes in the proportion of CD8+ T cells in the peripheral blood over time.

      We analyzed in vivo T-cell proliferation within tumor by CFSE (carboxyfluorescein succinimidyl ester) analysis. As shown in Fig. S6b, 6 days after infusion, B4GALT1 knockout OT-I T-cell showed increased proliferation within tumors, comparing with wild type control OT-I cells.

      (c) Evaluation of the proliferation and activation status of OT-1 CD8+ T cells specifically in the draining lymph nodes of the mouse model.

      Thank the reviewer for valuable suggestion! We plan to perform this experiment in the future.

      (3) The authors provide evidence that B4GALT1 knockout enhances CD8+ T cell function in both mouse models and human TCR-T cells (in vitro). Definitive support for the translational potential of this strategy would come from showing that B4GALT1-knockout human TCR-T cells also mediate potent in vivo function (NSG tumor-bearing model may be a better choice).

      Thank the reviewer for valuable suggestion! We are going to perform those experiments in the future. However, we do not expect that in vitro and in vivo (NSG mice) experiments will show much different results, which may also not add too much for current manuscript.

      (4) It would be preferable to include data on T cell activation and effector function (e.g., flow cytometry for IL-2, TNF-α, and IFN-γ, or ELISPOT) following stimulation with an OVA-specific peptide or co-culturing of OVA-expressing tumor cells with B4GALT1-knockout OT-1 CD8 T cells, especially the changes in the TILs compared with the non-targeting control group.

      Following co-culturing of B16-OVA tumor cells with B4GALT1-knockout or wild-type OT-I CD8<sup>+</sup> T-cells, the RNA levels and secretion levels of TNFα and IFNγ were detected by RT-qPCR and ELISA, respectively (Fig. 3c). B4GALT1-deficient OT-I T-cells showed increased expression of T-cell activation and cytotoxic markers such as IFNγ and TNFα.

      (5) What is the correlation between the expression of B4GALT1, PD-1, and TCR activation markers at various time points during a long-term T cell co-culture with tumor cells?

      Thanks for the reviewer for valuable suggestion! We don’t have this data now. While we agree that exploring this might be interesting, we think it falls outside the scope of the current study.

      (6) In line 136: Regarding the genetic targeting of B4GALT1 in T cells, it is unclear whether single or multiple gRNAs were used and if potential off-target effects were assessed. To fully validate the model, it would be important to clarify these strategies, and it is essential to include data on the knockout efficiency at both the protein (e.g., Western blot) and mRNA levels.

      We are sorry about the unclear statements for gene knockout strategy. In current study, single sgRNAs were used in all experiments for gene knockout. B4galt1 sg2 was used in Fig. 3a. Both B4galt1 sg1 and sg2 were used in Fig. S1d. We clarified this in each figure legend in revised version.

      The phenotypes of B4galt1 knockout T-cells could be rescued by overexpression of either a short or long isoform of mouse B4galt1 cDNA (Fig. 3b), indicating that potential off-target effects could be excluded.

      The sgRNA knockout efficiencies were confirmed by T7E1 assay in revised version (Fig. S2). Regrettably, anti-mouse B4galt1 antibody didn’t work in western blot.

    1. eLife Assessment

      This valuable work analyzes a large dataset of [NiFe]-CODHs, integrating genomic context, operon organization, and clade-specific gene neighborhoods to discern patterns of diversification and adaptation. A consistent examination of CODH genomic contexts, including CODH-HCP co-occurrence, informs interpretations of enzymatic activity, biotechnological potential, and differential functional roles, in line with current standards in genomic enzymology. With solid support, this work provides a broadly informative contribution to the field.

    2. Reviewer #1 (Public review):

      Summary:

      This manuscript analyzes a large dataset of [NiFe]-CODHs with a focus on genomic context and operon organization. Beyond earlier phylogenetic and biochemical studies, it addresses CODH-HCP co-occurrence, clade-specific gene neighborhoods, and operon-level variation, offering new perspectives on functional diversification and adaptation.

      Strengths:

      The study has a valuable approach.

      Comments on revised version:

      I am satisfied that the authors have adequately addressed my previous comments in the revised manuscript.

    3. Reviewer #2 (Public review):

      The authors present a comparative genomic and phylogenetic analysis aimed at elucidating the functions of nickel-dependent carbon monoxide dehydrogenases (Ni-CODHs) and hybrid-cluster proteins (HCPs). By examining gene neighborhoods, phylogenetic relationships, and co-occurrence patterns, they propose functional hypotheses for different CODH clades and highlight those with the greatest potential for biotechnological applications.

      A major strength of this work lies in its systematic and conceptually clear approach, which provides a rapid and low-cost framework for predicting the functional potential of newly identified CODHs based on sequence data and genomic context. The analysis is careful in minimizing false positives and offers valuable insights into the diversity and distribution of CODH enzyme clades.

    4. Author response:

      The following is the authors’ response to the original reviews.

      Public Reviews:

      Reviewer #1 (Public review):

      (1) Rationale for excluding clades G and H and clarification of clade definitions

      We appreciate this important request for clarification. In the revised manuscript, we now explicitly state (Methods, Tree generation) that the phylogenetic framework used in this study follows the clade definitions established by Techtmann et al. (Front. Microbiol. 2012, 3, 132), which classify [NiFe]-CODHs into clades based on high supporting values in nodes (bootstrap >75). We deem Techtmann et al.’s work as best lead, since their approach with two different types of trees (ML vs. Bayesian) gives solid support to this classification of clades. We ourselves did not perform Bayesian statistics, instead we used the known clades from literature to assign ours.

      Clades G and H were not deliberately excluded from downstream genomic-context and operon analyses. They were excluded by our pipeline, because their data did not fulfil our initial quality assessments, such as: host classified down to species level (https://github.com/boehmax/protein-per-organism), and protein exists in the IPG database of NCBI (https://github.com/boehmax/protein-to-genome).

      Clade G and H are both represented by only a very small number of sequences, most of which derive from fragmented or poorly annotated genomes, preventing reliable assessment of operon organization and gene neighbourhood conservation. As a result, inclusion of these clades would not allow statistically meaningful or biologically interpretable comparisons with clades A–F.

      To improve transparency, we have added a brief explanation of these limitations in the Results (Results, Neighbor analysis).

      (2) Presentation and interpretation of co-occurrence data

      We agree that the presentation of the co-occurrence data required improvement. In the revised supplementary material, we now include a table in the long format that might be easier to interpret than a matrix representation as seen in Fig. 3B.

      We have also revised the Results text to more precisely reflect the numerical trends. Specifically, we clarify that clade D shows co-occurrence with clades A, E and F, while clade C only displays co-occurrence with clade E. The statement that clades C and D “more often co-occur” has been removed and rephrased to avoid overgeneralization and to better align with the quantitative data shown in Figure 3B and the supplementary table (Results, Co-occurrence and Correlation).

      (3) Rationale for operon-level rather than organism-level analysis

      We thank the reviewer for highlighting this conceptual point. In the revised manuscript, we now explicitly state that our analysis was conducted at the operon level because individual genomes frequently encode multiple CODH operons that are phylogenetically and functionally distinct. Treating each operon as an independent functional unit allows us to capture this intra-genomic diversity and to associate specific gene neighbourhoods with individual CODH clades. We furthermore discuss in the introduction explicitly technical reasons why we decided to limit this study to the operon level for more transparency.

      Nevertheless, we acknowledge that this approach may overlook higher-level regulatory or physiological interactions among multiple CODHs encoded within the same genome. This limitation is now discussed explicitly, and we acknowledge that operon-level analysis should be a complementary, not exhaustive, framework for functional inference.

      Reviewer #2 (Public review):

      We thank Reviewer #2 for their positive assessment of the conceptual clarity and methodological utility of our approach, as well as for their thoughtful discussion of its limitations.

      Regarding incomplete genome assemblies, limited representation of class II HCPs, and potential omission of distal pathway components, we agree fully. We stress that our conclusions are probabilistic and hypothesis-generating rather than definitive functional assignments.

      In response to the concern about reproducibility of the visual filtering step, we have added a more explicit description (Methods, Data collection and refinement) of the criteria used to exclude non-CODH homologs (e.g., absence of conserved active-site motifs, unknown folds predicted with AlphaFold3, extremely long tree branches). This clarification improves transparency and facilitates replication of the analysis.

      Finally, we concur that extrapolating enzymatic activity or inactivity from a limited number of characterized representatives should be done cautiously. We have revised the wording throughout the manuscript to further temper such generalizations and to frame our interpretations explicitly as predictions that require experimental validation.

      Once again, we thank both reviewers for their constructive feedback, which has significantly improved the clarity, rigor, and transparency of the manuscript. We believe that the revisions address all concerns raised and strengthen the overall contribution of this work.

      Recommendation from authors:

      Reviewer #1 (Recommendations for the authors):

      All suggested editorial and stylistic corrections were implemented. These include refinements to the wording in the Abstract, grammatical corrections, streamlined phrasing, standardized figure callouts and supplementary file references, corrected abbreviations, and consistent formatting of references and author names. The only exception concerns the suggested change from MetCODH to MtCODH. We have retained MetCODH, as this abbreviation is well established in the literature for the Methanothermobacter thermophila CODH and is commonly used in prior studies (e.g., https://doi.org/10.1073/pnas.2410995121 ). MtCODH has historically been referring to CODH from Neomoorella thermoacetica (previously Moorella thermoacetica, hence the abbreviation Mt). We chose to rename that to NtCODH but to avoid confusion, keep MetCODH for Methanothermobacter thermophila.

      Reviewer #2 (Recommendations for the authors):

      We likewise addressed the majority of recommendations. We now report the versions of all software tools and databases used, standardized capitalization and naming of software and platforms (e.g., GitHub, eggNOG), clarified the BLAST implementation and database employed, and added direct repository links for custom scripts in both the Methods section and the bibliography. Overall grammatical consistency and formatting were improved throughout the manuscript. In addition, the criteria and procedure used for visual inspection to remove non-CODH sequences are now described more explicitly to enhance reproducibility, and several methodological sections were streamlined as suggested. Minor textual redundancies were removed, and phrasing was simplified where appropriate.

      Figure legends and formatting were revised to improve clarity and consistency. Adjustments to color usage and font consistency were made where feasible to enhance readability. The color scheme in Figure 1 was adjusted as suggested, and darker shades were chosen for clade H and G. This change was also implemented in the Supplementary File 9_Tree5. Figure 3A was retained, as it provides information on the frequency of multiple CODHs from the same clade within genomes, which cannot be inferred from the probability matrix shown in Figure 3B; together, these panels offer complementary insights. We adjusted the figure caption to make this clearer. We increased the visibility of data points in Figure 4B. To allow inclusion of the full dataset we did not collapse the x-axis as suggested. Figure 4C was retained in its original format to emphasize the characteristic operon “fingerprints” of each CODH clade, which is a central focus of this work. A table is supplied in Supplementary File 2, which allows data exploration with the preferred focus of the reader.

      A small number of suggestions were therefore not implemented exactly as proposed, primarily where alternative revisions were judged to better preserve clarity or analytical intent. These decisions are minor and do not affect the conclusions or reproducibility of the study.

      Overall, we believe that these revisions have substantially improved the manuscript’s readability, transparency, and technical rigor, and we thank the reviewers again for their careful and constructive feedback.

    1. eLife Assessment

      This study presents a valuable application of a video-text alignment deep neural network model to improve neural encoding of naturalistic stimuli in fMRI. The authors provide convincing evidence that models based on multimodal and dynamic embedding features of audiovisual movies predicted brain responses better than models based on unimodal or static features. The work will be of interest to researchers in cognitive neuroscience and AI-based brain modeling.

    2. Reviewer #1 (Public review):

      Summary:

      This study compares four models-VALOR (dynamic visual-text alignment), CLIP (static visual-text alignment), AlexNet (vision-only), and WordNet (text-only)-in their ability to predict human brain responses using voxel-wise encoding modeling. The results show that VALOR not only achieves the highest accuracy in predicting neural responses but also generalizes more effectively to novel datasets. In addition, VALOR captures meaningful semantic dimensions across the cortical surface and demonstrates impressive predictive power for brain responses elicited by future events.

      Strengths:

      The study leverages a multimodal machine learning model to investigate how the human brain aligns visual and textual information. Overall, the manuscript is logically organized, clearly written, and easy to follow. The results well support the main conclusions of the paper.

      Comments on revisions:

      I am happy with the response letter. I have no further comments on this manuscript.

    3. Reviewer #2 (Public review):

      Summary:

      Fu and colleagues have shown that VALOR, a model of multimodal and dynamic stimulus features, better predicts brain responses compared to unimodal or static models such as AlexNet, WordNet, or CLIP. The authors demonstrated robustness of their findings from generalizing encoding results to an external dataset. They demonstrated the models' practical benefit by showing that semantic mappings were comparable to another model that required labor-intensive manual annotation. Finally, the authors showed that the model reveals predictive coding mechanisms of the brain, which held meaningful relationship with individuals' fluid intelligence measure.

      Strengths:

      Recent advances in neural network models that extract visual, linguistic, and semantic features from real-world stimuli have enabled neuroscientists to build encoding models that predict brain responses from these features. Higher prediction accuracy indicates greater explained variance in neural activity, and therefore a better model of brain function. Commonly used models include AlexNet for visual features, WordNet for audio-semantic features, and CLIP for visuo-semantic features; these served as comparison models in the study. Building on this line of work, the authors developed an encoding model using VALOR, which captures the multimodal and dynamic nature of real-world stimuli. VALOR outperformed the comparison models in predicting brain responses. It also recapitulated known semantic mappings and revealed evidence of predictive processing in the brain. These findings support VALOR as a strong candidate model of brain function.

      Weaknesses:

      The authors argue that this modeling contributes to better understanding how the brain works. However, upon reading, I am less convinced how VALOR's superior performance than other models tell us more about the brain. VALOR is a better model of the audiovisual stimulus because it processes multimodal and dynamic stimuli compared to other unimodal or static models. If the model better captures real-world stimuli, then I almost feel that it has to better capture brain responses, assuming that the brain is a system that is optimized to process multimodal and dynamic inputs from the real world. The authors could strengthen the manuscript if the significance of their encoding model findings is better explained.

      In Study 3, the authors show high alignment between WordNet and VALOR feature PCs. Upon reading the method together with Figure 3, I suspect that the alignment almost has to be high, given that the authors projected VALOR features to the Huth et al.'s PC space. Could the authors conduct non-parametric permutation tests, such as shuffling the VALOR features prior to mapping onto Huth et al.'s PC space, and then calculating the Jaccard scores? I imagine that the null distribution would be positively shifted. Still, I would be convinced if the alignment is higher than this shifted null distribution for each PC. If my understanding about this is incorrect, I suggest editing the relevant Method section (line 508) because this analysis was not easy to understand.

      In Study 4, the authors show that individuals whose superior parietal gyrus (SPG) exhibited high prediction distance had high fluid cognitive scores (Figure 4C). I had a hard time believing that this was a hypothesis-driven analysis. The authors motivate the analysis that "SPG and PCu have been strongly linked to fluid intelligence (line 304)". Did the authors conduct two analyses only-SPG-fluid intelligence and PCu-fluid intelligence-without relating other brain regions with other individual differences measures? Even if so, the authors should have reported the same r value and p value for PCu-fluid intelligence. If SPG-fluid intelligence indeed hold specificity in terms of statistical significance compared to all possible scenarios that were tested, is this rationally an expected result and could the authors explain the specificity? Also, the authors should explain why they considered fluid intelligence to be the proxy of one's ability to anticipate upcoming scenes during movie watching. I would have understood the rationale better if the authors have at least aggregated predictive scores for all brain regions that held significance into one summary statistics and have found significant correlation with the fluid intelligence measure.

      Comments on revisions:

      The revision has addressed these concerns.

    4. Reviewer #3 (Public review):

      Summary:

      In this work, the authors aim to improve neural encoding models for naturalistic video stimuli by integrating temporally aligned multimodal features derived from a deep learning model (VALOR) to predict fMRI responses during movie viewing.

      Strengths:

      The major strength of the study lies in its systematic comparison across unimodal and multimodal models using large-scale, high-resolution fMRI datasets. The VALOR model demonstrates improved predictive accuracy and cross-dataset generalization. The model also reveals inherent semantic dimensions of cortical organization and can be used to evaluate the integration timescale of predictive coding.

      This study demonstrates the utility of modern multimodal pretrained models for improving brain encoding in naturalistic contexts. While not conceptually novel, the application is technically sound, and the data and modeling pipeline may serve as a valuable benchmark for future studies.

      Weaknesses:

      The overall framework of using data-driven features derived from pretrained AI models to predict neural response has been well studied and accepted by the field of neuroAI for over a decade. The demonstrated improvements in prediction accuracy, generalization, and semantic mapping are largely attributable to the richer temporal and multimodal representations provided by the VALOR model, not a novel neural modeling framework per se. As such, the work may be viewed as an incremental application of recent advances in multimodal AI to a well-established neural encoding pipeline, rather than a conceptual advance in modeling neural mechanisms.

      Within this setup, the finding that VALOR outperforms CLIP, AlexNet, and WordNet is somewhat expected. VALOR encodes rich spatiotemporal information from videos, making it more aligned with movie-based neural responses. CLIP and AlexNet are static image-based models and thus lack temporal context, while WordNet only provides coarse categorical labels with no stimulus-specific detail. Therefore, the results primarily reflect the advantage of temporally-aware features in capturing shared neural dynamics, rather than revealing surprising model generalization. A direct comparison to pure video-based models, such as Video Swin Transformers or other more recent video models, would help strengthen the argument.

      Moreover, while WordNet-based encoding models perform reasonably well within-subject in the HCP dataset, their generalization to group-level responses in the Short Fun Movies (SFM) dataset is markedly poorer. This could indicate that these models capture a considerable amount of subject-specific variance, which fails to translate to consistent group-level activity. This observation highlights the importance of distinguishing between encoding models that capture stimulus-driven representations and those that overfit to individual heterogeneities.

    5. Author response:

      The following is the authors’ response to the original reviews.

      Public Reviews:

      Reviewer #1 (Public review):

      This study compares four models - VALOR (dynamic visual-text alignment), CLIP (static visual-text alignment), AlexNet (vision-only), and WordNet (text-only) - in their ability to predict human brain responses using voxel-wise encoding modeling. The results show that VALOR not only achieves the highest accuracy in predicting neural responses but also generalizes more effectively to novel datasets. In addition, VALOR captures meaningful semantic dimensions across the cortical surface and demonstrates impressive predictive power for brain responses elicited by future events.

      Strengths:

      The study leverages a multimodal machine learning model to investigate how the human brain aligns visual and textual information. Overall, the manuscript is logically organized, clearly written, and easy to follow. The results well support the main conclusions of the paper.

      (1) My primary concern is that the performance difference between VALOR and CLIP is not sufficiently explained. Both models are trained using contrastive learning on visual and textual inputs, yet CLIP performs significantly worse. The authors suggest that this may be due to VALOR being trained on dynamic movie data while CLIP is trained on static images. However, this explanation remains speculative. More in-depth discussion is needed on the architectural and inductive biases of the two models, and how these may contribute to their differences in modeling brain responses.

      Thank you for this thoughtful comment. We agree that attributing VALOR’s advantage over CLIP solely to ‘dynamic (video) versus static (image) pretraining’ would be incomplete, and that the architectural and inductive biases of the two models are central to understanding the observed performance gap.

      Both VALOR and CLIP use contrastive learning to align visual and textual representations, but they differ in several key inductive biases that are particularly relevant for modeling brain responses during continuous movie viewing. First, VALOR is trained to align temporally extended video segments with text, introducing an explicit temporal integration window that aggregates information across consecutive frames. This encourages representations that maintain context, stabilize semantics across time, and encode event-level structure. Second, VALOR’s alignment operates at the level of multi-second narrative units, rather than isolated visual snapshots, biasing the model toward representations that are sensitive to unfolding events and cross-frame consistency.

      In contrast, CLIP processes frames independently and aligns single static images with text. As a result, it lacks an intrinsic mechanism for temporal binding, context accumulation, or event-level representation. While CLIP can capture rich visual–semantic associations at the image level, it is less well suited to represent higher-order temporal structure, which is known to strongly drive responses in association cortex during naturalistic narrative perception.

      We therefore interpret VALOR’s superior encoding performance as reflecting not only exposure to dynamic audiovisual data, but also inductive biases—temporal integration and event-level alignment—that more closely match how the brain integrates information over time during movie watching. We have revised the Discussion (p. 16) to articulate these architectural and representational differences explicitly, rather than attributing the effect solely to training data modality.

      (On page 16) “Additionally, VALOR exceeds the performance of CLIP, a leading static multimodal model, as its training objective aligns multi-second video–text units, enforcing a temporal integration window and event-level semantics that maintain cross-frame consistency and narrative context, whereas CLIP’s image-level alignment provides no intrinsic mechanism for such temporal continuity.”

      (2) The methods section lacks clarity regarding which layers of VALOR and CLIP were used to extract features for voxel-wise encoding modeling. A more detailed methodological description is necessary to ensure reproducibility and interpretability. Furthermore, discussion of the inductive biases inherent in these models-and their implications for brain alignment - is crucial.

      Thank you for this comment. We agree that reproducibility and interpretability require precise specification of which model representations were used for voxel-wise encoding, as well as clearer discussion of the inductive biases inherent in these models and their implications for brain alignment.

      In the revised Methods, we now explicitly specify the feature sources for both models. For CLIP (ViT-B/32), we use the final pooled image embedding after projection into the shared image–text space, extracted frame-by-frame; one representative frame is sampled per TR, and its projected embedding serves as the regressor. For VALOR, we use the final joint video–text projection head, yielding a 512-dimensional embedding computed at the segment/TR level that integrates information across consecutive frames and aligns each multi-second video segment with its associated text. These procedures are now described step-by-step in the Methods (p. 21).

      In addition, we expanded the Discussion (p. 16) to explicitly articulate the models’ inductive biases and their relevance for brain alignment. In particular, we contrast CLIP’s image-level, framewise alignment—which lacks intrinsic temporal integration—with VALOR’s event-level, temporally extended video–text alignment, which biases representations toward context maintenance and narrative continuity. This distinction helps explain why the two models differ in their ability to predict neural responses during continuous movie viewing.

      (Methods, On page 21)

      “(1) Video–text alignment features (VALOR): To extract video-based multimodal features, we used VALOR (VALOR-large checkpoint), an open-source pretrained video–text alignment model24. VALOR combines visual encoders (CLIP and Video Swin Transformer) for extracting visual features and a text encoder (BERT) for extracting textual features 23,51,52. These representations are aligned in a shared embedding space through contrastive learning. We segmented each movie at the TR level and, for each segment, extracted VALOR’s projected video–text embedding from the final projection head of the alignment module to obtain a 512-dimensional feature vector. These embeddings were then time-aligned to the corresponding BOLD responses.

      (2) CLIP features: To compare with static image-based multimodal models, we utilized CLIP (ViT-B/32), which aligns visual and textual representations through contrastive learning but processes individual frames independently without capturing temporal context. One video frame was sampled per TR, and the pooled image embedding after CLIP’s projection into the shared image–text space was extracted to obtain a 512-dimensional feature vector. These TR-aligned vectors were used directly as regressors in the voxel-wise encoding models.”

      (Discussion, On page 16)

      “Additionally, VALOR exceeds the performance of CLIP, a leading static multimodal model, as its training objective aligns multi-second video–text units, enforcing a temporal integration window and event-level semantics that maintain cross-frame consistency and narrative context, whereas CLIP’s image-level alignment provides no intrinsic mechanism for such temporal continuity. More broadly, this difference reflects distinct inductive biases in how the two models represent visual–linguistic information. CLIP is optimized for framewise image–text correspondence, encouraging representations that emphasize instantaneous visual semantics but remain agnostic to temporal structure. In contrast, VALOR is explicitly biased toward aggregating information over multiple consecutive frames and aligning representations at the level of temporally extended events. These inductive biases favor context maintenance, semantic stabilization, and narrative coherence over time, which are known to be critical for driving responses in association cortex during continuous movie perception.”

      (3) A broader question remains insufficiently addressed: what is the purpose of visual-text alignment in the human brain? One hypothesis is that it supports the formation of abstract semantic representations that rely on no specific input modality. While VALOR performs well in voxel-wise encoding, it is unclear whether this necessarily indicates the emergence of such abstract semantics. The authors are encouraged to discuss how the computational architecture of VALOR may reflect this alignment mechanism and what implications it has for understanding brain function.

      Thank you for this important conceptual question. We agree that improved voxel-wise encoding performance does not, by itself, imply the emergence of fully amodal or modality-independent semantic representations in the brain. In the revision, we therefore avoid framing our findings as evidence for abstract amodal semantics and instead clarify a more constrained interpretation.

      Specifically, we suggest that visual–text alignment may support the stabilization and coordination of scene-level meaning across modalities and over time, rather than the formation of modality-free semantic codes. From this perspective, VALOR’s advantage reflects inductive biases that promote (i) integration of visual information over multi-second windows and (ii) alignment of temporally extended visual events with linguistic descriptions, yielding representations that are more temporally stable, context-sensitive, and constrained by language.

      We therefore interpret VALOR’s superior encoding performance as identifying cortical regions whose responses are better captured by temporally stabilized, cross-modal representations, rather than as evidence that these regions encode fully abstract semantics independent of input modality. We have expanded the Discussion (p. 16) to articulate this interpretation and to clarify the implications of video–text alignment for understanding how the brain integrates perception and language during naturalistic cognition.

      (On page 16) “Together, the relative gains over AlexNet (purely visual), WordNet (manual semantic annotation), and CLIP (static image–text alignment) indicate cortical systems whose responses are best captured by multi-second, multimodal integration, and highlight regions that accumulate and stabilize narrative context over time. At the same time, these findings do not imply that visual–text alignment in the brain gives rise to fully amodal, modality-independent semantic representations. Instead, we suggest that alignment between visual and linguistic signals may serve to stabilize and coordinate scene-level meaning across modalities and over time. From this perspective, VALOR’s architecture—by integrating visual information over multi-second windows and aligning temporally extended video segments with language—provides a computational proxy for how the brain may use linguistic constraints to organize, disambiguate, and maintain coherent representations of unfolding events. The observed encoding gains therefore highlight regions engaged in temporally stabilized, cross-modal integration during naturalistic perception, rather than providing evidence for abstract semantic codes divorced from sensory input.”

      (4) The current methods section does not provide enough details about the network architectures, parameter settings, or whether pretrained models were used. If so, please provide links to the pretrained models to facilitate reproducible science.

      We appreciate this comment and agree that our original description of model sources and implementation details was not sufficiently explicit. These details are essential for both reproducibility and interpretability. We have now made these specifications explicit in the revised Methods.

      In particular, we now state for each model:

      VALOR. We use the publicly released pretrained VALOR-large checkpoint. For each movie segment, we extract the joint video–text projection head output (512-D) that encodes the aligned segment-level audiovisual semantics. We report the checkpoint source, the segment duration (in frames/seconds), and how these segment-level embeddings are temporally aligned to TRs for voxel-wise encoding.

      CLIP (ViT-B/32). We use the standard pretrained CLIP weights. For each video frame, we extract the final pooled image representation after projection into CLIP’s shared image–text embedding space (512-D). We also clarify that one representative frame is sampled and aligned to each TR, and that these projected embeddings are used as regressors in the encoding model.

      AlexNet. We use the ImageNet-pretrained AlexNet. We take activations from conv5, and then apply PCA to reduce them to 512 dimensions before mapping them to the fMRI time series.

      For each model, the revised Methods now specify: the pretrained source/checkpoint, the layer or head from which features were taken, output dimensionality, any preprocessing or dimensionality reduction, and the temporal alignment procedure used to generate TR-level regressors. These revisions appear in the updated Methods (page 21).

      (On page 21) “(1) Video–text alignment features (VALOR): To extract video-based multimodal features, we used VALOR (VALOR-large checkpoint), an open-source pretrained video–text alignment model24. VALOR combines visual encoders (CLIP and Video Swin Transformer) for extracting visual features and a text encoder (BERT) for extracting textual features 23,51,52. These representations are aligned in a shared embedding space through contrastive learning. We segmented each movie at the TR level and, for each segment, extracted VALOR’s projected video–text embedding from the final projection head of the alignment module to obtain a 512-dimensional feature vector. These embeddings were then time-aligned to the corresponding BOLD responses.

      (2) P features: To compare with static image-based multimodal models, we utilized CLIP (ViT-B/32), which aligns visual and textual representations through contrastive learning but processes individual frames independently without capturing temporal context. One video frame was sampled per TR, and the pooled image embedding after CLIP’s projection into the shared image–text space was extracted to obtain a 512-dimensional feature vector. These TR-aligned vectors were used directly as regressors in the voxel-wise encoding models.

      (3) AlexNet features: Visual features were extracted by sampling frames at the TR level and processing them with AlexNet, an eight-layer convolutional neural network comprising five convolutional layers followed by three fully connected layers. Features from all five convolutional layers were evaluated in preliminary analyses; the fifth convolutional layer showed the best performance and was used in subsequent analyses. Intra-image z-score normalization was applied to reduce amplitude effects. Principal component analysis (PCA) was used to reduce dimensionality, retaining the top 512 components to match the dimensionality of multimodal feature spaces. This pipeline was implemented using the DNNBrain toolkit 53.

      (4) WordNet features: Semantic features were obtained from publicly available WordNet annotations provided with the HCP dataset (7T_movie_resources/WordNetFeatures.hdf5), following the procedure of Huth et al. (2012). Each second of the movie clips was manually annotated with WordNet categories according to predefined guidelines: (a) identifying clear objects and actions in the scene; (b) labeling categories that dominated for more than half of the segment duration; and (c) using specific category labels rather than general ones. A semantic feature matrix was constructed with rows corresponding to time points and columns to semantic categories, with category presence coded as binary values. More specific categories from the WordNet hierarchy were added to each labeled category, yielding a total of 859 semantic features. These features were used directly as regressors. We also evaluated a PCA-reduced 512-dimensional variant (fit within each training fold to avoid leakage); because this version performed slightly worse, we report results from the full 859-dimensional representation in the main text. For the generalization analysis in Study 2, annotations for the SFM dataset were aligned to the same WordNet category space to ensure consistency.”

      Reviewer #2 (Public review):

      Fu and colleagues have shown that VALOR, a model of multimodal and dynamic stimulus features, better predicts brain responses compared to unimodal or static models such as AlexNet, WordNet, or CLIP. The authors demonstrated the robustness of their findings by generalizing encoding results to an external dataset. They demonstrated the models' practical benefit by showing that semantic mappings were comparable to another model that required labor-intensive manual annotation. Finally, the authors showed that the model reveals predictive coding mechanisms of the brain, which held a meaningful relationship with individuals' fluid intelligence measures.

      Strengths:

      Recent advances in neural network models that extract visual, linguistic, and semantic features from real-world stimuli have enabled neuroscientists to build encoding models that predict brain responses from these features. Higher prediction accuracy indicates greater explained variance in neural activity, and therefore a better model of brain function. Commonly used models include AlexNet for visual features, WordNet for audio-semantic features, and CLIP for visuo-semantic features; these served as comparison models in the study. Building on this line of work, the authors developed an encoding model using VALOR, which captures the multimodal and dynamic nature of real-world stimuli. VALOR outperformed the comparison models in predicting brain responses. It also recapitulated known semantic mappings and revealed evidence of predictive processing in the brain. These findings support VALOR as a strong candidate model of brain function.

      (1) The authors argue that this modeling contributes to a better understanding of how the brain works. However, upon reading, I am less convinced about how VALOR's superior performance over other models tells us more about the brain. VALOR is a better model of the audiovisual stimulus because it processes multimodal and dynamic stimuli compared to other unimodal or static models. If the model better captures real-world stimuli, then I almost feel that it has to better capture brain responses, assuming that the brain is a system that is optimized to process multimodal and dynamic inputs from the real world. The authors could strengthen the manuscript if the significance of their encoding model findings were better explained.

      We thank the reviewer for this thoughtful comment and agree with the premise that a model preserving multimodal and temporal structure might a priori be expected to better predict brain responses to naturalistic stimuli. Our intent is not to claim that higher accuracy alone explains brain function, but rather that where and how VALOR improves prediction provides diagnostic insight into cortical processing. We have revised the Discussion to make this distinction explicit.

      Specifically, we clarify three ways in which VALOR’s gains are scientifically informative rather than merely unsurprising:

      (1) Anatomical specificity of improvement. VALOR’s advantage is not uniform across the cortex; gains are largest in regions implicated in multi-second, cross-modal integration. This spatial pattern constrains where the brain accumulates information over time and stabilizes visual representations using linguistic context.

      (2) Model as a computational probe. Beyond prediction accuracy, VALOR’s feature space recovers large-scale semantic organization without manual annotation and enables targeted tests of predictive processing. Features reflecting upcoming content selectively improve fits in specific regions, consistent with anticipatory coding during continuous narrative perception.

      (3) Link to individual differences. Individuals whose neural responses are better captured by anticipatory features show higher fluid intelligence, suggesting that VALOR indexes meaningful variability in forward-looking representations rather than merely tracking stimulus complexity.

      Accordingly, we have revised the Discussion (p. 16) to frame VALOR as a tool for mapping cortical integration profiles, probing semantic and predictive structure, and linking representational dynamics to cognition, rather than asserting that higher encoding accuracy alone explains brain function.

      (On page 16) “Together, the relative gains over AlexNet (purely visual), WordNet (manual semantic annotation), and CLIP (static image–text alignment) indicate cortical systems whose responses are best captured by multi-second, multimodal integration, and highlight regions that accumulate and stabilize narrative context over time.”

      (2) In Study 3, the authors show high alignment between WordNet and VALOR feature PCs. Upon reading the method together with Figure 3, I suspect that the alignment almost has to be high, given that the authors projected VALOR features to the Huth et al.'s PC space. Could the authors conduct non-parametric permutation tests, such as shuffling the VALOR features prior to mapping onto Huth et al.'s PC space, and then calculating the Jaccard scores? I imagine that the null distribution would be positively shifted. Still, I would be convinced if the alignment is higher than this shifted null distribution for each PC. If my understanding of this is incorrect, I suggest editing the relevant Method section (line 508) because this analysis was not easy to understand.

      Thank you for this helpful comment and for pointing out a potential source of confusion. We apologize that the original Methods description was not sufficiently clear. Importantly, VALOR features were never projected into the Huth et al. PC space, and no optimization or rotation toward the WordNet basis occurred at any stage.

      The analysis proceeded as follows:

      (1) VALOR PCs. We first fit voxel-wise encoding models using VALOR features on the Huth et al. dataset. We then applied PCA to the resulting cortical weight maps, yielding spatial components (‘VALOR PCs’) that summarize shared patterns of VALOR feature weights across the cortex.

      (2) WordNet PCs. We used the semantic principal components reported by Huth et al. (2012) directly as published, with no refitting, projection, or modification using VALOR.

      (3) Correspondence analysis. Only after obtaining these two independent sets of cortical maps did we threshold each to their top-loading vertices and compute Jaccard overlap between VALOR PCs and WordNet PCs.

      Although a permutation that shuffles VALOR features prior to projection addresses a scenario that does not apply here, we agree that the Methods description should more clearly convey the independence of the two decompositions. We have therefore revised the Methods (p. 24) to describe the procedure step-by-step and explicitly state that no projection, refitting, or optimization toward the WordNet basis was performed.

      (On page 24) “We first fit voxel-wise encoding models using VALOR features for each of the five participants in the Huth et al. dataset. For each participant, this yielded a weight map linking each VALOR feature to each voxel. We then stacked these weight maps across participants to form a single voxel-by-feature weight matrix and applied principal component analysis (PCA). The top four principal components from this analysis (“VALOR PCs”) captured shared spatial patterns of VALOR feature weights across cortex. To interpret these components, we projected VALOR feature vectors from >20,000 video segments in the VALOR training set onto each VALOR PC, which revealed dominant semantic axes (e.g., mobility, sociality, civilization). For comparison, we used the semantic principal components reported by Huth et al. (2012) from their WordNet-based encoding model; these “WordNet PCs” were taken directly from the published work and were not refit or reweighted using VALOR.”

      (3) In Study 4, the authors show that individuals whose superior parietal gyrus (SPG) exhibited high prediction distance had high fluid cognitive scores (Figure 4C). I had a hard time believing that this was a hypothesis-driven analysis. The authors motivate the analysis that "SPG and PCu have been strongly linked to fluid intelligence (line 304)". Did the authors conduct two analyses only-SPG-fluid intelligence and PCu-fluid intelligence-without relating other brain regions to other individual differences measures? Even if so, the authors should have reported the same r-value and p-value for PCu-fluid intelligence. If SPG-fluid intelligence indeed holds specificity in terms of statistical significance compared to all possible scenarios that were tested, is this rationally an expected result, and could the authors explain the specificity? Also, the authors should explain why they considered fluid intelligence to be the proxy of one's ability to anticipate upcoming scenes during movie watching. I would have understood the rationale better if the authors had at least aggregated predictive scores for all brain regions that held significance into one summary statistic and found a significant correlation with the fluid intelligence measure.

      We thank the reviewer for this careful and constructive comment and agree that greater transparency about analytic intent, specificity, and rationale is needed. We have revised the manuscript accordingly.

      (1) Analytic scope and a priori restriction. The analysis in Fig. 4C was hypothesis-driven and restricted a priori to two regions — superior parietal gyrus (SPG) and precuneus (PCu) — based on convergent evidence linking frontoparietal and medial parietal systems to fluid reasoning, relational integration, and domain-general cognitive control. Importantly, we did not conduct a whole-brain search across regions or behaviors to identify the strongest correlation post hoc.

      (2) Specificity and reporting. In response to the reviewer’s request, we now report the full results for both hypothesized regions. Prediction horizon in SPG showed a statistically reliable association with fluid intelligence, whereas PCu showed a positive but weaker trend that did not survive correction. Reporting both results makes the regional specificity explicit rather than implicit.

      (3) Why SPG over PCu? Although both regions are implicated in fluid cognition, SPG has been more consistently linked to active maintenance and manipulation of relational structure and top-down attentional control, whereas PCu is more often associated with internally oriented and mnemonic processes. We therefore interpret the stronger SPG association as consistent with a role for sustained, externally driven predictive processing during continuous perception, rather than as evidence of exclusivity.

      (4) Why fluid intelligence? We do not equate fluid intelligence with “anticipation” per se. Rather, we used gF as an a priori proxy for domain-general capacities — maintaining and updating relational context over multi-second windows, integrating multiple constraints, and exerting flexible control — that are plausibly recruited when anticipating upcoming events during naturalistic narratives. The reported relationship is associative and hypothesis-consistent, not causal.

      (5) Why not aggregate across regions? We agree that aggregation could reveal more global relationships; however, our goal in this analysis was to test whether predictive timescales in theoretically motivated control regions relate to individual differences, rather than to maximize correlation by pooling heterogeneous regions. We now clarify this rationale in the Results.

      These clarifications and additional statistics have been incorporated in the revised Results section (p. 14).

      (On page 14) “Finally, we examined whether prediction horizons were linked to individual differences in cognition. We focused on fluid intelligence (gF) because gF is widely taken to index domain-general capacities such as maintaining and updating relational context over several seconds, integrating multiple constraints, and exerting flexible top-down control — functions that should support anticipating what will happen next in a continuous narrative. We targeted two parietal regions, the SPG and the PCu, which have both been repeatedly linked to gF and high-level cognitive control in the individual-differences literature 36,37. For each participant, we correlated fluid cognition scores with that participant’s average prediction horizon in each region. As shown in Fig. 4c, individuals with longer prediction horizons in SPG showed higher fluid cognition scores (SPG: r = 0.172, FDR-corrected p = 0.047). PCu showed a similar positive trend (PCu: r = 0.111, FDR-corrected p = 0.146) but did not reach significance. These associations suggest that the ability to sustain a longer predictive timescale during naturalistic perception co-varies with broader fluid cognitive capacity. No additional brain regions or behavioral measures were examined in this analysis.”

      Reviewer #3 (Public review):

      In this work, the authors aim to improve neural encoding models for naturalistic video stimuli by integrating temporally aligned multimodal features derived from a deep learning model (VALOR) to predict fMRI responses during movie viewing.

      Strengths:

      The major strength of the study lies in its systematic comparison across unimodal and multimodal models using large-scale, high-resolution fMRI datasets. The VALOR model demonstrates improved predictive accuracy and cross-dataset generalization. The model also reveals inherent semantic dimensions of cortical organization and can be used to evaluate the integration timescale of predictive coding.

      This study demonstrates the utility of modern multimodal pretrained models for improving brain encoding in naturalistic contexts. While not conceptually novel, the application is technically sound, and the data and modeling pipeline may serve as a valuable benchmark for future studies.

      (1) Lines 95-96: The authors claim that "cortical areas share a common space," citing references [22-24]. However, these references primarily support the notion that different modalities or representations can be aligned in a common embedding space from a modeling perspective, rather than providing direct evidence that cortical areas themselves are aligned in a shared neural representational space.

      We thank the reviewer for this important clarification. We agree that the cited works do not provide direct evidence that cortical areas themselves are aligned in a single neural representational space. Rather, they demonstrate that representations derived from different modalities can be mapped into a shared embedding space from a modeling and computational perspective.

      We have therefore revised the text to avoid overstatement and to more precisely reflect what these studies support. In the revised manuscript (p. 4), we now frame the claim in terms of a shared representational framework or feature space used for modeling, rather than implying that cortical areas themselves intrinsically share a unified neural space. This clarification aligns the conceptual claim with the scope of the cited literature.

      (On page 4) “As a result, researchers are turning to multimodal deep learning, which learns from visual, linguistic, and auditory streams to model complex brain functions. This trend is supported by neuroscience evidence that cortical responses across regions can be jointly modeled within a common representational space.”

      (2) The authors discuss semantic annotation as if it is still a critical component of encoding models. However, recent advances in AI-based encoding methods rely on features derived from large-scale pretrained models (e.g., CLIP, GPT), which automatically capture semantic structure without requiring explicit annotation. While the manuscript does not systematically address this transition, it is important to clarify that the use of such pretrained models is now standard in the field and should not be positioned as an innovation of the present work. Additionally, the citation of Huth et al. (2012, Neuron) to justify the use of WordNet-based annotation omits the important methodological shift in Huth et al. (2016, Nature), which moved away from manual semantic labeling altogether. Since the 2012 dataset is used primarily to enable comparison in study 3, the emphasis should not be placed on reiterating the disadvantages of semantic annotation, which have already been addressed in prior work. Instead, the manuscript's strength lies in its direct comparison between data-driven feature representations and semantic annotation based on WordNet categories. The authors should place greater emphasis on analyzing and discussing the differences revealed by these two approaches, rather than focusing mainly on the general advantage of automated semantic mapping.

      Thank you for this thoughtful and constructive comment. We agree with the reviewer that the field has largely transitioned away from manual semantic annotation toward features derived from large-scale pretrained models (e.g., CLIP, GPT-style architectures), and that this shift is now standard rather than a novelty of the present work.

      We have revised the manuscript to clarify this positioning. Our goal is not to claim automated semantic extraction as an innovation, but rather to demonstrate how a multimodal, temporally informed video–text model can be used as a direct feature space for voxel-wise encoding of naturalistic movie fMRI data. VALOR is used as a representative example of this broader class of pretrained models, and our emphasis is on the general modeling approach rather than on promoting a specific architecture.

      We also agree that our original discussion underemphasized the important methodological shift introduced in Huth et al. (2016, Nature), which moved away from manual semantic labeling in the context of continuous spoken narratives. We now explicitly acknowledge this work and clarify that our use of WordNet-based annotations from Huth et al. (2012) serves a different purpose: it provides an interpretable, historically grounded benchmark for comparison in Study 3, rather than a claim that semantic annotation remains necessary or state-of-the-art.

      In response to the reviewer’s suggestion, we have revised the Results (p.10) and Discussion (p.18) to place greater emphasis on what is revealed by directly comparing data-driven multimodal features with category-based semantic annotation under matched conditions. Specifically, we focus on how these two approaches converge at the level of large-scale semantic organization while differing in their flexibility, temporal resolution, and dependence on human-defined categories. These revisions better reflect the current state of the field and sharpen the manuscript’s central contribution as a principled comparison between modeling approaches, rather than a general argument for automated semantic mapping.

      (On page 10) “Study 3: Comparing data-driven multimodal representations with category-based semantic annotation

      A central question in naturalistic encoding is how data-driven feature representations derived from pretrained models relate to more interpretable, category-based semantic annotations that have historically been used to study cortical semantic organization. Although recent work has shown that pretrained language and vision–language models can capture semantic structure without explicit annotation, category-based approaches such as WordNet remain valuable as interpretable reference frameworks. Here, we leverage the WordNet-based semantic components reported by Huth et al. (2012) 5 not as a state-of-the-art alternative, but as a historically grounded benchmark, allowing a controlled comparison between data-driven multimodal representations and manually defined semantic categories under matched naturalistic movie stimuli.”

      (On page 18) “Study 3 demonstrates the utility of video–text alignment models for probing higher-order semantic representations during naturalistic perception. Our comparison between VALOR-derived representations and WordNet-based semantic components highlights an important distinction between data-driven and category-based approaches to modeling meaning in the brain. While multimodal pretrained models offer flexible, high-dimensional representations that capture semantic structure without explicit annotation, category-based frameworks provide interpretability and theoretical anchoring 4,48. Using WordNet-based labeling from prior work as an interpretable reference point, we show that VALOR automatically extracts semantic dimensions—including mobility, sociality, and civilization—that closely mirror those identified using manual semantic categories (Fig. 3). The observed alignment between VALOR PCs and WordNet semantic components suggests that large-scale semantic organization emerges consistently across these approaches, even though they differ in how semantic structure is defined and learned. This convergence supports the use of pretrained multimodal models as practical encoding tools for naturalistic stimuli, while also underscoring the continued value of interpretable semantic benchmarks for understanding which aspects of meaning are represented across cortex. We do not argue that semantic annotation is required for modern encoding models; rather, WordNet-based features serve here as a historically grounded and interpretable reference for contextualizing data-driven multimodal representations.”

      (3) The authors use subject-specific encoding models trained on the HCP dataset to predict group-level mean responses in an independent in-house dataset. While this analysis is framed as testing model generalization, it is important to clarify that it is not assessing traditional out-of-distribution (OOD) generalization, where the same subject is tested on novel stimuli, but rather evaluating which encoding model's feature space contains more stimulus-specific and cross-subject-consistent information that can transfer across datasets.

      We thank the reviewer for this helpful clarification and agree that the type of generalization tested here should be described more precisely. Our analysis does not assess classical within-subject out-of-distribution (OOD) generalization, in which the same individual is tested on novel stimuli.

      Instead, for each HCP participant we train a subject-specific encoding model and transfer it to predict group-mean responses in an independent in-house dataset collected at a different site, with different participants, different movies, and different acquisition conditions. This design evaluates which encoding model’s feature space contains stimulus-locked representations that are consistent across individuals and robust to changes in dataset and experimental context, rather than within-subject stimulus novelty per se.

      We have revised the Results (p. 10) and Discussion section (p. 17) to explicitly describe this analysis as a test of cross-subject and cross-dataset transferability of stimulus representations, and to clarify the distinction from traditional OOD generalization.

      (On Page 10) “Although this analysis is not a classical within-subject out-of-distribution generalization test, it evaluates the extent to which different feature spaces capture stimulus-locked representations that are consistent across subjects and transferable across datasets, stimuli, and acquisition environments.”

      (On Page 17) “By contrast, VALOR exhibited stronger generalization in a cross-cohort, cross-stimulus, and cross-site transfer evaluation.”

      (4) Within this setup, the finding that VALOR outperforms CLIP, AlexNet, and WordNet is somewhat expected. VALOR encodes rich spatiotemporal information from videos, making it more aligned with movie-based neural responses. CLIP and AlexNet are static image-based models and thus lack temporal context, while WordNet only provides coarse categorical labels with no stimulus-specific detail. Therefore, the results primarily reflect the advantage of temporally-aware features in capturing shared neural dynamics, rather than revealing surprising model generalization. A direct comparison to pure video-based models, such as Video Swin Transformers or other more recent video models, would help strengthen the argument.

      We thank the reviewer for this baseline-focused comment and agree that, in naturalistic movie paradigms, a temporally structured audiovisual model would be expected to outperform static or unimodal feature spaces. Our intent in this comparison is therefore not to claim a surprising advantage, but to isolate which inductive biases matter for cross-dataset transfer of movie-evoked neural responses.

      The baseline models were chosen deliberately to span feature spaces that are widely used and interpretable in cognitive neuroscience: AlexNet (vision-only, frame-based), WordNet (human-defined semantic categories without learned visual features), and CLIP (static image–text alignment without temporal context). Comparing VALOR against these established baselines under matched preprocessing, TR alignment, and dimensionality control allows us to attribute performance differences specifically to temporal integration and audiovisual alignment, rather than to generic model capacity.

      We agree that a direct comparison with purely visual spatiotemporal encoders (e.g., Video Swin or TimeSformer-style models) would further dissociate the contribution of temporal visual processing from cross-modal video–text alignment. We now explicitly note this as an important direction for future work and frame VALOR as one representative of a broader class of multimodal video models, rather than as a uniquely optimal solution (Discussion, p. 16).

      (On page 16) “Second, we did not directly compare VALOR to state-of-the-art video-only spatiotemporal models (e.g., Video Swin Transformer, VideoMAE, and related architectures) that are designed to capture temporal visual structure without language grounding; such comparisons will be important for isolating the specific contributions of temporal visual processing versus cross-modal video–text alignment in naturalistic neural responses.”

      (5) Moreover, while WordNet-based encoding models perform reasonably well within-subject in the HCP dataset, their generalization to group-level responses in the Short Fun Movies (SFM) dataset is markedly poorer. This could indicate that these models capture a considerable amount of subject-specific variance, which fails to translate to consistent group-level activity. This observation highlights the importance of distinguishing between encoding models that capture stimulus-driven representations and those that overfit to individual heterogeneities.

      Thank you for this thoughtful observation. We agree with the reviewer’s interpretation. In our analyses, WordNet-based models perform reasonably well when fit and evaluated within individual HCP participants, but their performance degrades substantially when transferred to predict group-averaged responses in the independent SFM dataset. This dissociation suggests that, while WordNet annotations capture meaningful variance at the individual level, a larger fraction of that variance may be subject-specific or idiosyncratic, and therefore does not translate into consistent, stimulus-locked responses at the group level.

      One motivation for our cross-dataset, cross-subject evaluation is precisely to distinguish encoding models that primarily capture shared stimulus-driven structure from those whose apparent performance depends more strongly on individual heterogeneity. In this context, the reduced transferability of WordNet-based models highlights a potential limitation of category-based semantic features for capturing population-consistent neural dynamics during naturalistic viewing.

      We note that this effect likely reflects multiple factors rather than a single failure mode, including differences in annotation schemes, labeling granularity, and semantic coverage across datasets. By contrast, video–text models provide time-aligned linguistic features directly from the stimulus itself, reducing reliance on dataset-specific human annotation and exhibiting stronger transfer across cohorts. We have clarified this interpretation in the revised Discussion (p. 17).

      (Page 17) “Together, these findings underscore the importance of distinguishing encoding models that primarily capture shared, stimulus-driven neural structure from those whose performance relies more heavily on subject-specific heterogeneity, particularly when evaluating generalization across participants and datasets.”

      Recommendations for the authors:

      Reviewer #1 (Recommendations for the authors):

      (1) In the Methods section, please clarify which specific layer of VALOR the 512-dimensional feature vector was extracted from.

      Thank you for this suggestion. We have revised the Methods to state explicitly that the 512-dimensional feature vector is extracted from VALOR’s joint video–text projection head, i.e., the final projection layer of the contrastive alignment module that maps video and text representations into a shared embedding space. We also clarify that these 512-D embeddings are computed at the segment/TR level and then time-aligned to the BOLD signal (Methods, p. 21).

      (On page 21) “We segmented each movie at the TR level and, for each segment, extracted VALOR’s projected video–text embedding from the final projection head of the alignment module to obtain a 512-dimensional feature vector. These embeddings were then time-aligned to the corresponding BOLD responses.”

      (2) It would be helpful to include more detailed descriptions of the network architectures and parameters for all models used.

      Thank you for the suggestion. We have revised the Methods to include model-specific subsections for all feature spaces used (VALOR, CLIP, AlexNet, and WordNet). For each model, we now explicitly report (i) the backbone architecture and training objective, (ii) the exact feature source (layer or projection head) and output dimensionality, and (iii) how features were temporally aligned to the BOLD signal. All models were used with their publicly released pretrained parameters, without additional fine-tuning. These additions are intended to improve transparency and reproducibility (Methods, p. 21).

      (On page 21) “Movie Feature Extraction

      (1) Video–text alignment features (VALOR): To extract video-based multimodal features, we used VALOR (VALOR-large checkpoint), an open-source pretrained video–text alignment model24. VALOR combines visual encoders (CLIP and Video Swin Transformer) for extracting visual features and a text encoder (BERT) for extracting textual features 23,51,52. These representations are aligned in a shared embedding space through contrastive learning. We segmented each movie at the TR level and, for each segment, extracted VALOR’s projected video–text embedding from the final projection head of the alignment module to obtain a 512-dimensional feature vector. These embeddings were then time-aligned to the corresponding BOLD responses.

      (2) CLIP features: To compare with static image-based multimodal models, we utilized CLIP (ViT-B/32), which aligns visual and textual representations through contrastive learning but processes individual frames independently without capturing temporal context. One video frame was sampled per TR, and the pooled image embedding after CLIP’s projection into the shared image–text space was extracted to obtain a 512-dimensional feature vector. These TR-aligned vectors were used directly as regressors in the voxel-wise encoding models.

      (3) AlexNet features: Visual features were extracted by sampling frames at the TR level and processing them with AlexNet, an eight-layer convolutional neural network comprising five convolutional layers followed by three fully connected layers. Features from all five convolutional layers were evaluated in preliminary analyses; the fifth convolutional layer showed the best performance and was used in subsequent analyses. Intra-image z-score normalization was applied to reduce amplitude effects. Principal component analysis (PCA) was used to reduce dimensionality, retaining the top 512 components to match the dimensionality of multimodal feature spaces. This pipeline was implemented using the DNNBrain toolkit 53.

      (4) WordNet features: Semantic features were obtained from publicly available WordNet annotations provided with the HCP dataset (7T_movie_resources/WordNetFeatures.hdf5), following the procedure of Huth et al. (2012). Throughout this manuscript, we use the term “semantic features” to refer to such human-annotated, category-based representations of scene content, and we reserve the term “linguistic features” for continuous language embeddings derived automatically from pretrained language or vision–language models. Each second of the movie clips was manually annotated with WordNet categories according to predefined guidelines: (a) identifying clear objects and actions in the scene; (b) labeling categories that dominated for more than half of the segment duration; and (c) using specific category labels rather than general ones. A semantic feature matrix was constructed with rows corresponding to time points and columns to semantic categories, with category presence coded as binary values. More specific categories from the WordNet hierarchy were added to each labeled category, yielding a total of 859 semantic features. These features were used directly as regressors. We also evaluated a PCA-reduced 512-dimensional variant (fit within each training fold to avoid leakage); because this version performed slightly worse, we report results from the full 859-dimensional representation in the main text. For the generalization analysis in Study 2, annotations for the SFM dataset were aligned to the same WordNet category space to ensure consistency.”

      (3) In Figure 3, consider following Huth et al.'s approach by using 3-4 distinct colors to visualize semantic representations across the cortical surface more clearly.

      Thank you for this excellent suggestion. We have generated an alternative visualization using a discrete 3–4 color scheme following Huth et al. to display the semantic components on the cortical surface. This version makes the spatial correspondence between components and the boundaries between cortical territories easier to see. We now include this visualization in the Supplement (Fig. S3)

      (4) In Figure 2, the brain renderings are too small. Please consider creating a separate, enlarged figure with clearer delineation of relevant ROIs.

      We appreciate this suggestion and agree that clear delineation of ROIs is important. We evaluated larger brain renderings; however, within the multi-panel layout of Fig. 2, enlarging them compressed accompanying plots/legends and introduced visual crowding, which reduced overall readability. To preserve a balanced layout and consistent typography across panels, we have kept the current rendering size in the main text and added Fig. S4 with enlarged brain renderings showing clearer ROI boundaries for the same ROIs.

      Reviewer #2 (Recommendations for the authors):

      (1) From the introduction, I feel like naïve readers would have a hard time understanding what semantic models (e.g., WordNet) are, which the authors write are based on "labor-intensive and subjective manual annotation of semantic content". It would be straightforward to explain the process-how scientists have written descriptions or denoted categories of what's happening within a TR and transformed these into embedding vectors based on language models. This description would explain what the authors mean by "labor-intensive, time-consuming, and subjective". Related to this point, the authors seem to be using the words "semantic model/feature" and "linguistic model/feature" interchangeably, which may exacerbate the confusion.

      Thank you for this helpful suggestion. We agree that naïve readers would benefit from a clearer explanation of how “semantic” models such as WordNet are constructed and from a more precise distinction between semantic and linguistic features.

      In response, we expanded the Introduction (p. 3) to explicitly describe the process by which semantic features are generated via dense human annotation (i.e., raters label objects, actions, and events within each TR and map these labels onto a predefined ontology to form feature vectors), clarifying why this approach is labor-intensive, time-consuming, and subject to rater variability.

      To avoid disrupting the conceptual flow of the Introduction, we placed the explicit terminology clarification in the Methods section (p. 22), where feature extraction is described. There, we now define semantic features as human-annotated, category-based representations of scene content, and linguistic features as continuous language embeddings derived automatically from pretrained language or vision–language models. These revisions are intended to improve clarity and consistency for both expert and non-expert readers.

      (On page 3) “Critically, semantic models often rely on dense human annotation. In early naturalistic encoding studies, trained raters watched the stimulus and labeled what was happening within each TR or short time window—for example, identifying objects, actions, or events present in the scene. These labels were then mapped onto a predefined semantic ontology (such as WordNet), yielding high-dimensional categorical feature vectors that served as regressors in encoding models. While this approach provides interpretable semantic features, it is labor-intensive, time-consuming, and inherently subjective, as annotations depend on rater judgment, labeling guidelines, and dataset-specific conventions, limiting scalability and reproducibility.”

      (On page 22) “Throughout this manuscript, we use the term “semantic features” to refer to such human-annotated, category-based representations of scene content, and we reserve the term “linguistic features” for continuous language embeddings derived automatically from pretrained language or vision–language models.”

      (2) Figure 1A does not look like an accurate schematic of the encoding method. For example, shouldn't the "Train" give rise to weight matrices, and Movies come from moments at Test? I would appreciate it if this schematic figure would explain what the encoding model is to naïve readers.

      (3) Figure 1B emphasizes that VALOR is utilizing multimodal features, but does not emphasize that the model is trained on dynamic video. The current figure looks like the model extracted visual and linguistic features from a screenshot of the video, much like the CLIP model.

      Thank you for this helpful comment. We agree that the original Fig. 1A did not sufficiently clarify what is learned during training versus what is applied during testing, and that this distinction is particularly important for naïve readers unfamiliar with encoding models. We also agree that the original Fig. 1B did not sufficiently emphasize that VALOR is trained on dynamic video segments, and that the schematic could be misinterpreted as aligning a single video frame with text, similar to CLIP-style image–text models.

      We have revised Fig. 1A (p. 6) to make the encoding procedure explicit and pedagogical. Specifically, we now clearly depict that, during the training phase (HCP dataset), voxel-wise encoding models learn feature-to-voxel weight matrices from stimulus features and BOLD responses. These learned weights are explicitly labeled as voxel-wise weight matrices and visually associated with the training stage. In the testing/generalization phase (SFM dataset), we now indicate that these learned weights are held fixed and applied to features extracted from novel movies to generate predicted BOLD responses. Additional labels were added to distinguish “Training (learn weights)” from “Testing/Transfer (apply fixed weights)” and to clarify that the encoding model implements a linear mapping from stimulus features to voxel responses. We have also rewritten the Fig. 1 legend (p. 6) to explicitly explain the encoding workflow in words, including (i) the learning of voxel-specific weights during training, (ii) their reuse during cross-dataset transfer, and (iii) how generalization performance is evaluated. These changes are intended to ensure that Fig. 1A accurately reflects the encoding methodology and is understandable to readers without prior experience with encoding models.

      We have revised Fig. 1B (p. 6) to explicitly highlight the temporal nature of the video input used by VALOR. In the updated schematic, the visual stream is depicted as a sequence of consecutive frames spanning multiple seconds, grouped into a video segment, rather than as a single static image. Additional labels indicate that VALOR encodes temporally extended video clips and aligns them with corresponding textual descriptions in a shared embedding space via contrastive learning. We have also updated the figure legend (p. 6) to clarify that VALOR operates on multi-frame video segments and explicitly models temporal structure, distinguishing it from static image–text models such as CLIP. These changes are intended to make clear that VALOR’s advantage derives not only from multimodality, but also from learning representations over time.

      (4) Regarding Figure 2, why were paired t-tests conducted in one-sided comparisons? Shouldn't this be two-sided, given that there is no reason to assume one is higher or lower than another?

      Thank you for raising this point. We agree that, in the absence of a preregistered directional hypothesis, paired comparisons should be evaluated using two-sided statistical tests.

      In response, we have re-run all paired comparisons reported in Figure 2 (p. 9) using two-sided paired t-tests, recomputed the corresponding p-values and false discovery rate (FDR) corrections, and updated the significance markers in the figure and captions accordingly. Importantly, this change does not alter the qualitative pattern of results or the main conclusions reported in the manuscript.

      (5) Regarding Study 4, I am curious whether the results are specific to forward-looking representations (predictive coding) or whether the results broadly reveal regions that are sensitive to contexts. For example, if the authors were to incorporate nearby past scenes in the analysis rather than the nearby future scenes, would different brain regions light up?

      Thank you for this thoughtful question. We agree that it is important to distinguish forward-looking (predictive) representations from more general sensitivity to temporal context. In Study 4, we deliberately operationalized prediction using future-aligned features, such that only information from upcoming scenes was incorporated into the encoding model. Accordingly, the reported effects should be interpreted as reflecting forward-oriented representations rather than generic context sensitivity.

      To make this interpretive scope explicit, we have added a clarifying sentence at the beginning of the Study 4 paragraph in the Discussion (p.18), noting that our analysis incorporates only future-aligned features and that directly contrasting past- and future-aligned features will be an important direction for future work. This clarification is intended to clearly bound our claims while addressing the reviewer’s conceptual distinction..

      (On page 18) “In Study 4, we used a video-text alignment model to investigate predictive coding mechanisms. Because our analysis incorporates only future-aligned features, the reported effects should be interpreted as reflecting forward-oriented representations rather than generic sensitivity to temporal context; directly contrasting past- and future-aligned features will be an important direction for future work.”

      (6) In the paragraph starting in line 447, were WordNet feature time series also reduced to 512 dimensions like the rest of the model features?

      Thank you for the question. In the main analyses, WordNet feature time series were not reduced to 512 dimensions and were instead used at their full dimensionality (859 features).

      For comparability with the other feature spaces, we additionally conducted a control analysis in which WordNet features were reduced to 512 dimensions using PCA. The PCA was fit within each training fold to avoid information leakage, and the resulting 512-D features were evaluated using the same encoding pipeline. This PCA-reduced version performed slightly worse than the full 859-D WordNet representation. Accordingly, we report results from the full 859-D WordNet features in the main text. We have clarified this point in the Methods section (p. 22).

      (On page 22) “We also evaluated a PCA-reduced 512-dimensional variant (fit within each training fold to avoid leakage); because this version performed slightly worse, we report results from the full 859-dimensional representation in the main text.”

      (7) I don't think authors have written what VALOR stands for.

      Thank you for the reminder. We now define the VALOR acronym at its first mention in the Abstract and Introduction and use the abbreviation thereafter.

      (On page 2) “Using a state-of-the-art deep learning model (VALOR; Vision-Audio-Language Omni-peRception)”

      (On page 5) “To answer this, we apply a video-text alignment encoding framework, using VALOR (Vision-Audio-Language Omni-peRception)—a high-performing, open-source model that aligns visual and linguistic features over time—to predict brain responses during movie watching.”

      (8) When calculating equation (3), please make sure that the correlation values are Fisher's r-to-z transformed.

      Thank you for this reminder. We confirm that all correlation coefficients used in Equation (3) are now Fisher r-to-z transformed prior to any averaging, contrasts, or statistical testing, and this procedure is now explicitly stated in the Methods. We have also updated Fig. 4a (p. 15) to reflect this transformation. Importantly, applying the r-to-z transformation does not change the qualitative pattern of results or their statistical significance.

      (9) I wasn't able to check the OSF data/codes because it required permission.

      Thank you for flagging this, and we apologize for the inconvenience. We have removed the permission restriction and set the OSF repository to public read-only access, which should resolve the issue.

      Reviewer #3 (Recommendations for the authors):

      (1) The current approach extracts features from a single "best" layer of each model, which may be suboptimal for predicting neural responses. Prior work has shown that combining features across multiple layers through optimized fusion strategies (e.g., St-Yves et al., 2023) or using model ensembles (e.g., Li et al., 2024) can substantially improve encoding performance. The authors may consider these more comprehensive approaches either as additional baselines or as alternative directions to enhance model accuracy.

      Thank you for this constructive suggestion. We agree that combining features across multiple layers or using optimized fusion and ensemble strategies, as demonstrated in recent work (e.g., St-Yves et al., 2023; Li et al., 2024), can substantially improve absolute encoding performance.

      In the present study, however, we intentionally evaluated each model using its single best-performing layer within a matched encoding pipeline. This design choice was made to maintain model-agnostic comparability and interpretability, and to ensure that performance differences could be attributed primarily to the type of representation (e.g., temporally informed video–text features versus static or unimodal features), rather than to differences in model complexity, parameter count, or fusion strategy. Importantly, this constraint was applied uniformly across all models and therefore does not favor VALOR over the baselines.

      We now explicitly note in the Discussion (p. 19) that multilayer fusion and ensemble approaches represent a natural and promising extension of our framework and are likely to further improve absolute prediction accuracy. Our goal in the current work was to establish the practical utility and generalizability of temporally aligned video–text features for naturalistic movie fMRI under a controlled and comparable evaluation setting..

      (On page 19) “Third, for comparability across models we evaluated each model using its single best-performing layer within a matched encoding pipeline rather than using multilayer fusion or ensembling, which allowed us to attribute performance differences to representational format but likely underestimates the absolute performance ceiling.”

      (2) Given the naturalistic video-based task, the manuscript would benefit from including state-of-the-art video-only models (e.g., Video Swin Transformer, VideoMAE, and other more recent architectures) as explicit baselines. These models are designed to capture spatiotemporal structure without relying on language input and would provide a more targeted comparison to assess the specific contribution of temporal visual processing.

      Thank you for this thoughtful suggestion. We agree that state-of-the-art video-only spatiotemporal models (e.g., Video Swin Transformer, VideoMAE) are highly relevant baselines for naturalistic movie paradigms and would provide a more targeted comparison for isolating the contribution of temporal visual processing independent of language input.

      In the present study, our primary goal was not to exhaustively benchmark all possible video architectures, but to evaluate whether temporally informed video–text features can serve as a practical and general-purpose encoding framework that improves upon the models most commonly used in cognitive neuroscience for naturalistic fMRI (e.g., AlexNet for vision, WordNet for semantic annotation, and CLIP for static multimodal alignment). Using these established baselines allowed us to place our results in direct continuity with prior neuroimaging work and to attribute performance differences to representational format under a controlled encoding pipeline.

      We agree that incorporating modern video-only spatiotemporal encoders is an important next step, particularly for disentangling the relative contributions of temporal visual structure and cross-modal video–text alignment. We now explicitly note this point in the Discussion (p.19) as a limitation and future direction, and view such comparisons as a natural extension of the current framework within the same TR-aligned encoding setup.

      (On page 19) “Second, we did not directly compare VALOR to state-of-the-art video-only spatiotemporal models (e.g., Video Swin Transformer, VideoMAE, and related architectures) that are designed to capture temporal visual structure without language grounding; such comparisons will be important for isolating the specific contributions of temporal visual processing versus cross-modal video–text alignment in naturalistic neural responses.”

      (3) An additional consideration is the scale of the AI models used for feature extraction. Previous studies (e.g., Matsuyama et al., 2023) have indicated that model size - particularly the number of parameters - can influence neural prediction performance, independently of architecture. A discussion or analysis of how model size contributes to the observed encoding gains would help clarify whether improvements are due to the representational quality of the model or simply its scale

      Thank you for this important point. We agree that model scale—particularly parameter count—can influence neural prediction performance independently of architecture, as noted in prior work (e.g., Matsuyama et al., 2023).

      In the present study, our primary goal was to evaluate whether temporally informed video–text representations provide practical advantages over unimodal and static multimodal baselines that are widely used in cognitive neuroscience for naturalistic movie fMRI, under a matched encoding pipeline. We did not perform a systematic scale-controlled analysis in this revision because doing so would require training or evaluating multiple size-matched variants across video-only and video–text architectures, which is beyond the scope of the current work.

      We therefore agree that part of the observed performance gains may reflect model capacity in addition to representational format, and we caution against attributing all improvements solely to cross-modal alignment or temporal structure. We now explicitly acknowledge this limitation in the Discussion and note that comparing size-matched video-only and video–text models within the same pipeline is an important next step for disentangling model scale from representational content.

      (On page 19) “Finally, part of VALOR’s advantage may reflect model capacity: larger pretrained models often yield higher encoding accuracy, so repeating these analyses with size-matched image-only and image–text models will be critical for disentangling model scale from representational content.”

    1. eLife Assessment

      Huang and colleagues examined neural responses in mouse anterior cingulate cortex (ACC) during a discrimination-avoidance task. The authors present useful findings that ACC neurons encode primarily post-action variables or "action content" over extended periods. Though the methodological approach was sound, the evidence in support of action state encoding, ruling out alternative explanations related to movement, is incomplete.

    2. Reviewer #1 (Public review):

      Summary:

      Huang et al. examined ACC response during a novel discrimination-avoid task. The authors concluded that ACC neurons primarily encode post-action variables over extended periods, reflecting the animal's preceding actions rather than the outcomes or values of those actions. The authors have made considerable revisions to address the raised concerns. However, it appears that some important issues remain unresolved.

      Strengths:

      The inclusion of new figures and analyses in response to the reviews is appreciated, such as Fig. 2 and 5.

      Weaknesses:

      Motion related signal in ACC: the new Fig. 2E looks good, but it is hard to visualize how it is just a reordering of the old Fig. 5C.

      All categories in the new Fig. 4D appear to respond to shuttle initiation, with less than 1s latency. For example, type 2a/2b consists of 40% of the population and their response to movement onset is apparent. Thus, it is not clear whether most neurons respond to shuttle crossing as described in the manuscript.

      Could the authors use relatively simple analysis, such as comparing spike rate before and after crossing, or before and after initiation, to quantify the response properties of each neuron? This could also help validate the classification analysis performed in Fig. 4.

    3. Reviewer #2 (Public review):

      Summary:

      Huang et al recorded anterior cingulate cortex activity in mice while they performed a shuttle escape task. The task utilized two auditory cues, each of which informed the mice to stay or escape depending on which side they were on, and incorrect responses were punished by shock administration. Analyses focused on ACC neurons that fired when mice crossed the shuttle box in either direction (A-->B or B-->A), coined "action state", or when mice crossed in one direction but not the other, coined "action content". The authors characterized these populations, and ACC firing changes mostly occurred around the time of shuttle crossing. This work will likely be of broad interest to those who are interested in neocortical neurophysiology broadly, anterior cingulate cortex specifically, and their contributions to learning about actions. The task is well-designed and provides a nice background for neurophysiological recordings. The authors leveraged these strengths in characterizing the neural populations that fire to shuttle crossings in both directions vs one direction.

      Strengths:

      The factorial design nicely controls for sensory coding and value coding, since the same stimulus can signal different actions and values.

      The figures are well presented, labeled, and easy to read.

      Additional analyses, such as the 2.5/7.5s windows and place-field analysis, are nice to see and indicate that the authors were careful in their neural analyses.

      The n-trial + 1 analysis where ACC activity was higher on trials that preceded correct responses is a nice addition, since it shows that ACC activity predicts future behavior, well before it happens.

      The authors identified ACC neurons that fire to shuttle crossings in one direction or to crossings in both directions. This is very clear in the spike rasters and population scaled color images. While other factors such as place fields, sensory input, and their integration can account for this activity, the authors discuss this and provide additional supplemental analyses.

      Weaknesses:

      Some of the neural analyses could use the necessary and sufficient comparisons to strengthen the authors' claims.

      Comment on revised version:

      I think the authors did a very admirable job revising the manuscript. It is much improved. However, I believe a formal analysis of action-state versus action-content neurons on A-->B versus B-->A crossing is still warranted. I appreciate the fact that this analysis may not be as reliable with smaller ensemble sizes, but with careful pseudo-ensemble and resampling approaches, such an analysis would go a long way towards increasing the strength of evidence.

    4. Reviewer #3 (Public review):

      Summary:

      The authors record from the ACC during a task in which animals must switch contexts to avoid shock as instructed by a cue. As expected, they find neurons that encode context, with some encoding of actions prior to the context, and encoding of neurons post-action. The primary novelty is dynamic encoding of action-outcome in a discrimination-avoidance domain, while this is traditionally done using operant methods.

      Comments on revised version:

      I appreciate the considerable work done on review, and additional details added throughout. I also noted the additional sessions included in analyses, and additional behavioral data in response to R1 and R2's insightful comments.

      The only remaining comment that was not addressed pertains to anatomy and recording details. Some electrodes appear to be clearly in M2 (Fig 2A), and the tetrodes were driven each day. I would strongly suggest that this be included as a further limitation, particularly given the statement on line 178.

    5. Author response:

      The following is the authors’ response to the original reviews.

      Public Reviews:

      Reviewer #1 (Public review):

      Summary:

      In the current study, Huang et al. examined ACC response during a novel discrimination-avoid task. The authors concluded that ACC neurons primarily encode post-action variables over extended periods, reflecting the animal's preceding actions rather than the outcomes or values of those actions. Specifically, they identified two subgroups of ACC neurons that responded to different aspects of the actions. This work represents admirable efforts to investigate the role of ACC in task-performing mice. However, in my opinion, alternative explanations of the data were not sufficiently explored, and some key findings were not well supported.

      Strengths:

      The development of the new discrimination-avoid task is applauded. Single-unit electrophysiology in task-performing animals represents admirable efforts and the datasets are valuable. The identification of different groups of encoding neurons in ACC can be potentially important.

      Weaknesses:

      One major conclusion is that ACC primarily encodes the so-called post-action variables (specifically shuttle crossing). However, only a single example session was included in Figure 2, while in Supplementary Figure 2 a considerable fraction of ACC neurons appears to respond to either the onset of movement or ramp up their activity prior to movement onset. How did the authors reach the conclusion that ACC preferentially respond to shuttle crossing?

      We now include more example sessions and the main results from individual animals (Fig. 3; Figs. S2–S3; Fig. 8). Overall, the results are consistent across recording sessions and animals.

      While shuttle crossings were the primary reference for most analysis, using shuttle initiation as a reference led to similar conclusions (Fig.4). Namely, we found that most ACC neurons exhibit either robust (22%; Types 1a & 2a) or moderate (51%; Types 1b & 2b) post-shuttle activity changes (Fig.4), while only a subset exhibits ramping pre-shuttle activity (16%; Types 3b & 3c). Therefore, our conclusion was intended to highlight the role of post-shuttle activity in learning. While we do not exclude the possibility that pre-shuttle ACC activity contributes to learning, its involvement is likely more limited.

      In Figure 4, it was concluded that ACC neurons respond to action independent of outcome. Since these neurons are active on both correct and incorrect shuttle but not stay trials, they seem to primarily respond to overt movement. If so, the rationale for linking ACC activity and adaptive behavior/ associative learning is not very clear to me. Further analyses are needed to test whether their firing rates correlated with locomotion speed or acceleration/deceleration. On a similar note, to what extent are the action state neurons actually responding to locomotion-related signals? And can ACC activity actually differentiate correct vs. incorrect stays?

      In this study, we highlight two distinct groups of ACC neurons: action-state and action-content neurons. Both groups of neurons tend to show sustained activity even when the animals remain immobile after completing shuttle behaviors, suggesting that their activity is not directly driven by locomotion. Furthermore, action-content neurons are selectively engaged in only one of the two shuttle categories, either rooms A→B or B→A shuttles. Therefore, differences in neuronal activity are unlikely to reflect locomotor differences, given that both shuttle types involve similar movement patterns. Finally, we analyzed ACC neuronal activity in relation to locomotion speed. Our results indicate that only a small fraction of neurons (<15%) show speed-correlated activity (Fig.5), suggesting that most ACC neurons do not encode movement-related information. Taken together, these findings support the distinction between ACC activity and locomotion encoding.

      As for the small subset of speed-related neurons, it remains unclear whether these speed-related neurons represent a distinct subpopulation within the ACC or reflect recordings from the nearby motor cortex. Postmortem examination of the recording sites suggests that most neurons were recorded from the ACC, while a small subset may be located at the border between the ACC and motor cortex (Fig. S2). Therefore, it is possible that the small fraction of speed-related neurons originated from the motor cortex.

      Lastly, given that the ACC neurons display no or limited activity during stay trials, their activity generally does not differentiate correct vs. incorrect stays (Fig.S7). However, ACC activity does show moderate differentiation between room-A vs. room-B stays (Fig.S7).

      Given that a considerable amount of ACC neurons encode 'action content', it is not surprising that by including all neurons the model is able to make accurate predictions in Figure 6. How would the model performance change by removing the content neurons?

      We thank the reviewer for this thoughtful analysis idea. Excluding action-content neurons drastically reduces decoding accuracy (Fig.8), suggesting that they are the main drivers for differentiating rooms AB vs. BA shuttles.

      Moving on to Figure 7. Since Figure 4 showed that ACC neurons respond to movement regardless of outcome, it is somewhat puzzling how ACC activity can be linked to future performance.

      As discussed earlier (point #2), ACC activity does not simply reflect locomotion itself. We interpret the post-shuttle ACC activity as encoding both the preceding shuttle state (shuttle or stay) and shuttle content (rooms AB or BA). Regardless of the outcome (safety or shock), such encoding is essential for cue–action–outcome associative learning, because both positive and negative feedback can drive learning. The level of post-shuttle ACC activity may reflect task engagement, with greater engagement facilitating learning and improving future performance.

      Two mice contributed about 50% of all the recorded cells. How robust are the results when analyzing mouse by mouse?

      We have added further analysis of highlighting the results of each mouse. Although the total number of recorded neurons varied across mice, the major findings were consistent. In every mouse, we observed sustained post-shuttle ACC activity (Fig.S2), and population-level ACC activity reliably decoded shuttle contents (rooms AB vs. BA; Fig.8).

      Lastly, the development of the new discrimination-avoid task is applauded. However, a major missing piece here is to show the importance of ACC in this task and what aspects of this behavior require ACC.

      We appreciate this feedback. We are currently conducting additional experiments to determine whether inhibiting ACC activity during distinct time windows disrupts task learning. We hope to publish a follow-up paper on these findings in the near future.

      Reviewer #2 (Public review):

      Summary:

      The current dataset utilized a 2x2 factorial shuttle-escape task in combination with extracellular single-unit recording in the anterior cingulate cortex (ACC) of mice to determine ACC action coding. The contributions of neocortical signaling to action-outcome learning as assessed by behavioral tasks outside of the prototypical reward versus non-reward or punished vs non-punished is an important and relevant research topic, given that ACC plays a clear role in several human neurological and psychiatric conditions. The authors present useful findings regarding the role of ACC in action monitoring and learning. The core methods themselves - electrophysiology and behavior - are adequate; however, the analyses are incomplete since ruling out alternative explanations for neural activity, such as movement itself, requires substantial control analyses, and details on statistical methods are not clear.

      Strengths:

      (1) The factorial design nicely controls for sensory coding and value coding, since the same stimulus can signal different actions and values.

      (2) The figures are mostly well-presented, labeled, and easy to read.

      (3) Additional analyses, such as the 2.5/7.5s windows and place-field analysis, are nice to see and indicate that the authors were careful in their neural analyses.

      (4) The n-trial + 1 analysis where ACC activity was higher on trials that preceded correct responses is a nice addition, since it shows that ACC activity predicts future behavior, well before it happens.

      (5) The authors identified ACC neurons that fire to shuttle crossings in one direction or to crossings in both directions. This is very clear in the spike rasters and population-scaled color images. While other factors such as place fields, sensory input, and their integration can account for this activity, the authors discuss this and provide additional supplemental analyses.

      Weaknesses:

      (1) The behavioral data could use slightly more characterization, such as separating stay versus shuttle trials.

      We appreciate this feedback. In the revised manuscript, we present data separating stay versus shuttle trials (Fig.1). Additionally, we provide new data from extended training sessions (Fig.S2).

      (2) Some of the neural analyses could use the necessary and sufficient comparisons to strengthen the authors' claims.

      We have now used the necessary and sufficient comparisons where applicable. In the SVM decoding analysis, we show that population ACC activity is sufficient to decode AB or BA shuttles. We also show that excluding action-content, but not other ACC neurons, drastically reduces decoding accuracy, suggesting that these neurons are necessary for the decoding (Fig.8).

      (3) Many of the neural analyses seem to utilize long time windows, not leveraging the very real strength of recording spike times. Specifics on the exact neural activity binning/averaging, tests, classifier validation, and methods for quantification are difficult to find.

      We chose to perform our neural analyses on a longer time scale, given the sustained activity we see in the data. To further justify that decision, we now provide additional results highlighting the sustained activity of ACC neurons in our task (Fig.2; Fig.S2). Additionally, we now provide more specifics of the neural analyses in Methods section.

      (4) The neural analyses seem to suggest that ACC neurons encode one variable or the other, but are there any that multiplex? Given the overwhelming evidence of multiplexing in the ACC a bit more discussion of its presence or absence is warranted.

      This is an interesting point of discussion, and we thank the reviewer for pointing this out. Overall, our results suggest that individual ACC neurons preferentially engage in only one of the proposed functions, rather than multiplexing across them. For example, action-state and action-content ACC neurons primarily engage in action monitoring, but not in decision-making, planning, or outcome tracking. Nevertheless, we cannot rule out the possibility that other ACC neurons, through their distinct connectivity or location in different ACC subregions, engage in other proposed functions. Thus, when considering the ACC as a whole, its function may still be multiplexed.

      Another possible reason we do not see clear multiplexing of neurons may be due to the dynamic nature of our task. Unlike established tasks that often assign fixed positive or negative values to cues, the cues in our task are not inherently associated with valence. Instead, their meaning is dynamically determined by the animal’s location (context) at the time of cue presentation. Since values are not fixed and change based on context, value-related responses may not be reflected in the ACC in our tasks.

      We have now incorporated the above discussions into our revised manuscript.

      Reviewer #3 (Public review):

      Summary:

      The authors record from the ACC during a task in which animals must switch contexts to avoid shock as instructed by a cue. As expected, they find neurons that encode context, with some encoding of actions prior to the context, and encoding of neurons post-action. The primary novelty of the task seems to be dynamically encoding action-outcome in a discrimination-avoidance domain, while this is traditionally done using operant methods. While I'm not sure that this task is all that novel, I can't recall this being applied to the frontal cortex before, and this extends the well-known action/context/post-context encoding of ACC to the discrimination-avoidance domain.

      While the analysis is well done, there are several points that I believe should be elaborated upon. First, I had questions about several details (see point 3 below). Second, I wonder why the authors downplayed the clear action coding of ACC ensembles. Third, I wonder if the purported 'novelty' of the task (which I'm not sure of) and pseudo-debate on ACC's role undermines the real novelty - action/context/outcome encoding of ACC in discrimination-avoidance and early learning.

      Strengths:

      Recording frontal cortical ensembles during this task is particularly novel, and the analyses are sophisticated. The task has the potential to generate elegant comparisons of action and outcome, and the analyses are sophisticated.

      Weaknesses:

      I had some questions that might help me understand this work better.

      (1) I wonder if the field would agree that there is a true 'debate' and 'controversy' about the ACC and conflict monitoring, or if this is a pseudodebate (Line 34). They cite 2 very old papers to support this point. I might reframe this in terms of the frontal cortex studying action-outcome associations in discrimination-avoidance, as the bulk of evidence in rodents comes from overtrained operant behavior, and in humans comes from high-level tasks, and humans are unlikely to get aversive stimuli such as shocks.

      We appreciate this feedback. We have revised the Introduction and Discussion.

      (2) Does the purported novelty of the task undermine the argument? While I don't have an exhaustive knowledge of this behavior, the novelty involves applying this ACC. There are many paradigms where a shock triggers some action that could be antecedents to this task.

      We argue our newly designed discrimination–avoidance task is unique for several reasons. First, it requires animals to discriminate both sensory cues and environment contexts. Unlike established tasks that often assign fixed positive or negative values to cues, the cues in our task are not inherently associated with valence. Instead, their meaning is dynamically determined by the animal’s location (context) at the time of cue presentation, which reflects a conceptual advance over previous techniques. Furthermore, by removing valence from the cues, this design helps disentangle the ACC’s potential role in value encoding from other cognitive functions.

      Second, this task involves robust, ethologically relevant actions (i.e., shuttles), unlike many established paradigms that rely on less naturalistic behaviors such as saccades or lever presses. We view this as a key distinction from prior approaches, as even previous paradigms that utilize shutting responses or other naturalistic responses, fail to incorporate dynamic integration of cues and contexts.

      Finally, the clear temporal separation between actions and outcomes further helps disentangle the ACC’s roles in action monitoring vs. outcome tracking.

      (3) The lack of details was confusing to me:

      (a) How many total mice? Are the same mice in all analyses? Are the same neurons? Which training day? Is it 4 mice in Figure 3? Five mice in line 382? An accounting of mice should be in the methods. All data points and figures should have the number of neurons and mice clearly indicated, along with a table. Without these details, it is challenging to interpret the findings.

      We are sorry for the confusion. We now provide additional details and clear N numbers for each analysis to improve clarity.

      (b) How many neurons are from which stage of training? In some figures, I see 325, in some ~350, and in S5/S2B, 370. The number of neurons should be clearly indicated in each figure, and perhaps a table.

      All data were obtained from well-trained mice. For some analyses, the N is smaller because certain task sessions contained very few incorrect trials (≤3), which prevented us from examining ACC activity during those trials. We have modified figure legend so that neuron count is clear.

      (c) Were the tetrodes driven deeper each day? The depth should be used as a regressor in all analyses?

      Yes, the tetrodes were driven slightly deeper across task sessions (~80 µm per step; 2–4 depths per mouse). Given limited depth changes, preliminary analyses indicate no clear differences in ACC activity across these recording depths. However, we cannot rule out potential dorsal–ventral subregion differences if recordings were to span larger depth ranges.

      (d) Was is really ACC (Figure 2A)? Some shanks are in M2? All electrodes from all mice need to be plotted as a main figure with the drive length indicated.

      We have now included a supplementary figure showing all recording sites (Fig.S2). It is likely that a small subset of neurons was recorded at the ACC/M2 border area. Unfortunately, we are unable to separate them out due to blind recording design of our tetrode arrays.

      (e) It's not clear which sessions and how many go into which analysis

      We have now specified the number of task sessions for each analysis (see Methods).

      (f) How many correct and incorrect trials (<7?) are there per session?

      We have now specified the number of correct and incorrect trials per session (see Methods).

      (g) Why 'up to 10 shocks' on line 358? What amplitudes were tried? What does scrambled mean?

      We decided to use up to 10 mild shocks per trial because mice do not necessarily shuttle to the safe room after one or even a few shocks during the early stages of training. This design allows mice to efficiently learn the concept of the task (i.e., one room is safe while the other delivers shocks). Each shock was specified in the Methods section as 0.5 mA, 0.1 s. A “scrambled shock” refers to an electric shock delivered through multiple floor bars in a randomized pattern, effectively preventing the animal from avoiding the stimulus.

      (4) Why do the authors downplay pre-action encoding? It is clearly evident in the PETHs, and the classifiers are above chance. It's not surprising that post-shuttle classification is so high because the behavior has occurred. This is most evident in Figure S2B, which likely should be a main figure.

      We did not intend to downplay pre-action encoding. Our analysis shows that most ACC neurons exhibit either robust (22%; Types 1a & 2a) or moderate (51%;Types 1b & 2b) post-shuttle activity changes (Fig.4). Although a subset of ACC neurons exhibits ramping pre-shuttle activity, they represent a much smaller fraction (16%; Types 3b & 3c). Therefore, our conclusion was intended to highlight the role of post-shuttle activity in learning. While we do not exclude the possibility that pre-shuttle ACC activity contributes to learning, its involvement is likely more limited

      (5) The statistics seem inappropriate. A linear mixed effects model accounting for between-mouse variance seems most appropriate. Statistical power or effect size is needed to interpret these results. This is important in analyses like Figure 7C or 6B.

      We appreciate this feedback. We now use appropriate statistics and report effect size.

      (6) Better behavioral details might help readers understand the task. These can be pulled from Figures S2 and S5. This is particularly important in a 'novel' task.

      We now provide more details to help better understand the task and have added new figures (Fig.1; Figs. S1&S2).

      (7) Can the authors put post-action encoding on the same classification accuracy axes as Figure 6B? It'd be useful to compare.

      We appreciate the comment, but we are unsure what clarification is being requested.

      (8) What limitations are there? I can think of several - number of animals, lack of causal manipulations, ACC in rodents and humans.

      We now include discussions on limitation of our study. One caveat of our study is that the discrimination–avoidance task requires weeks of training in mice. By the time they master the task, ACC activity may reflect modified neural circuits. Investigating ACC activity during early phase of learning, such as by introducing a new pair of cues or contexts, could provide further insights into ACC’s role in learning and cognitive processes. Additionally, a limitation of the current study is the lack of evidence for the causal role of post-action ACC activity in complex associative learning. Future investigations using closed-loop strategies to selectively disrupt ACC activity during the post-action phase could help address this question.

      Minor:

      (1) Each PCA analysis needs a scree plot to understand the variance explained.

      We have added a scree plot for each PCA analysis.

      (2) Figure 4C - y and x-axes have the same label?

      We have corrected the y-axis label.

      (3) What bin size do the authors use for machine learning (Not clear from line 416)?

      The bin sizes used were 2.5, 5, 7.5, or 10 sec which have now been discussed in the Methods section.

      (4) Why not just use PCA instead of 'dimension reduction' (of which there are many?)

      We have adjusted the phrasing where appropriate.

      (5) Would a video enhance understanding of the behavior?

      We appreciate this feedback. We now include a few videos to accompany our paper.

      Recommendations for the authors:

      Reviewer #1 (Recommendations for the authors):

      (1) Is Figure 1C sufficiently powered?

      We have now included data from additional mice and updated the figure accordingly.

      (2) Task performance was not plateaued after 10 sessions in Figure 1B. How variable is task performance in the datasets with ephys recordings (session to session, mouse to mouse).

      We have now included additional data from extended training (15 sessions; Fig.S2). Moderate variations across both sessions and mice are observed. Specifically, the total number of correct/incorrect shuttles used for ephys analysis are 19/5, 19/4, 21/5, 20/4 (mouse #1; 4 sessions); 20/7, 23/7, 20/7 (mouse #2; 3 sessions); 19/4, 16/2 (mouse #3; 2 sessions); 26/4, 23/4, 17/6, 25/5 (mouse #4; 4 sessions); 20/5, and 17/4 (mouse #5; 2 sessions), respectively.

      (3) Please quantify the results in Figure 3, for both within individual mice and across mice.

      We have calculated maximum trajectory length within the 3-D space (Fig. 3C).

      (4) What is the effect size in Figure 7C?

      We now report the effect size.

      (5) Please provide more details for spike sorting.

      We have now included more details in the Methods section.

      (6) More detailed cell type or correlation analysis in Figures 4 and 5 may be helpful. For example, if putative regular and fast-spiking neurons were simultaneously recorded, did the FS directly inhibit the RS to give rise to the apparent encoding properties?

      We recorded a small number of putative interneurons (n = 13) from only three mice, which precludes drawing meaningful conclusions, particularly given their heterogeneous responses during discrimination–avoidance tasks. Accordingly, we include only an example interneuron demonstrating discrimination between AB vs. BA shuttles (Fig. S5). Nevertheless, it is evident there are reciprocal monosynaptic connections between putative interneurons and certain pyramidal neurons, as indicated by short-latency (~2 ms) excitatory or inhibitory interactions (Fig. S5). That said, follow up studies with greater Ns are needed to parse out these details

      Reviewer #2 (Recommendations for the authors):

      (1) While I appreciate displaying the success rate for the sake of simplifying behavioral data in Figure 1B, it would be nice to also see these data broken out as correct vs incorrect for stay vs shuttle trials, since it is difficult to determine whether the performance increases are primarily driven by mice improving at stay vs shuttle responses

      We appreciate this feedback. In the revised manuscript, we present data separating stay versus shuttle trials (Fig.1; Fig.S2).

      (2) In Figure 2 the comparison between shuttle and stay is not particularly convincing, since the comparison is also essentially movement vs no movement and place1-->place2 vs place1-->place1. A more appropriate comparison might be action state neurons vs action content neurons during A-->B, B-->A, or both crossings. If it is true that these populations contain this information, then action state neurons should traverse a large component space in both directions, action content neurons only one direction, and so on.

      We agree that the comparison is not ideal due to differences in locomotion. However, it provides valuable information suggesting that the ACC plays a limited role during stay trials, despite these trials involve mental and cognitive processes comparable to shuttle trials. While we appreciate the reviewer’s suggestion, the proposed analysis is not particularly reliable given the relatively small number of simultaneously recorded action-state or action-content neurons.

      (3) I would say the above point applies to Figure 3 as well. I would also note that this reviewer greatly appreciates the rigor of showing ensemble activity in each subject.

      We appreciate this comment. See our response above.

      (4) In Figure 5 do these neurons show the same A-->B vs B-->A firing patterns during correct vs incorrect shuttles? The text describing the data in Figure 4 suggests this should be the case but even from a quick glance it sort of seems like the population dynamics during correct vs incorrect shuttles are not the same. My concern is that averaging neural activity over 5s windows washes out all these dynamics

      Preliminary analysis suggests that these firing patterns apply to both correct and incorrect shuttles. However, the main reason we did not compare correct and incorrect trials is the limited amount of data. In many sessions, there are only a few (≤5) incorrect shuttles, which include both AB or BA shuttles (Fig.1C; Fig.S2), thus lacking the statistical power for a meaningful comparison.

      (5) Some information on classifier validation is required - was this leave-out validation and if so how many trials were left-out vs tested? K-fold, and if so, how many folds? Was the trial order shuffled for each simulation? Classifiers will pick up within-session temporal information. In addition to this classifier accuracy during the different time points should be compared by a non-parametric test, and compared to the 95th percentile of the label-shuffled distribution.

      Yes, we use standard 10-fold cross-validation. We appreciate the suggestion on trial-order shuffling, and implementing this procedure does not change our original conclusion. Additionally, we have applied a non-parametric test.

      (6) How exactly were neurons classified as content vs state? Was it the average activity during the 5s following the shuttle? If this is stated I could not really find it easily so I might suggest clarifying.

      We now use a new method for classification of the two neuron types (Fig.7). We have included detailed methods in the revised manuscript.

      (7) Movement drives cortical neuron activity more than anything else I have ever seen. Really, more than anything else, it would be nice to demonstrate that it is not movement alone or movement multiplexed with place/sensory information/direction driving these responses.

      We have analyzed ACC neuronal activity in relation to locomotion speed. Our results indicate that only a small fraction of ACC neurons (<15%) show speed-correlated activity (Fig.5). It remains unclear whether these speed-related neurons represent a distinct subpopulation within the ACC or reflect recordings from nearby motor cortex. Postmortem examination of the recording sites suggests that most neurons were recorded from the ACC, while a small subset may be located at the border between the ACC and motor cortex. Therefore, it is possible that the small fraction of speed-related neurons originated from the motor cortex.

      Furthermore, we identify two distinct groups of ACC neurons: <iaction-state and action-content neurons, both of which tend to show sustained activity even when the animals remain immobile after completing shuttle behaviors. This prolonged activation in the absence of movement suggests that their activity is not directly driven by locomotion. Moreover, action-content neurons are selectively engaged in only one of the two shuttle categories, either rooms AB or BA shuttles. Therefore, differences in neuronal activity are unlikely to reflect locomotor differences, given that both shuttle types involve similar movement patterns.

      (8) In addition to the above, the place-field analysis in Supplemental Figure 5 only shows 4 neurons. Was the whole population analyzed? Is it possible to decode place from the population during the ITI? The data in this figure sort of look exactly like place fields - many cortical neurons and also some hippocampal neurons have more than 1 place field

      We have now provided additional place-field analysis. A comparison with hippocampal CA1 neurons (recorded during the same task) suggests that ACC neurons encode limited spatial information.

      (9) "a simple Pavlovian association strategy is unlikely to be sufficient for learning the task" ... is Pavlovian occasion setting not a simple association? Tones and contexts both readily act as Pavlovian occasion setters. Similarly positive/negative patterning might also explain how the task is learned.

      We appreciate this comment and have revised the sentence accordingly. It is possible that animals use multiple strategies to learn and perform the task effectively. In the early stages, animals may rely more heavily on sensory–spatial integration, whereas in later stages, sensory- or location-related Pavlovian associative strategies may contribute to performance, particularly when animals begin to show place preferences during inter-trial intervals.

      (10) I might suggest softening this language and others like it. For example, 2x2 factorial designs are not really novel.

      We have revised the language used to describe the task.

      (11) Some of the color-scale bars and figures do not have labels. For example, Supplementary Figure 3, Supplementary Figure 5. Please add labels.

      We have added the missing labels to all color bars.

      Reviewer #3 (Recommendations for the authors):

      (1) Some relevant papers that should be cited:

      https://doi.org/10.1523/JNEUROSCI.4450-08.2008

      10.1016/j.neuron.2018.11.016

      https://doi.org/10.1016/j.jphysparis.2014.12.001

      We appreciate these suggestions.

      (2) Where can we download the data and code?

      We will upload the essential data and MATLAB code to GitHub to accompany the publication of the final version of this paper.

    1. eLife Assessment

      This important study addresses the unresolved and long-debated question of whether atypical protein kinase C is required for the maintenance of synaptic potentiation and long-term memory. The results confirm previous findings that persistent activity of PKMζ is required for lasting potentiation of hippocampal synapses and spatial memory. The study also adds new genetic evidence to support the earlier suggestion that enhanced expression of PKC iota/lambda compensates for the genetic reduction of PKM zeta to support synaptic potentiation and memory; however, the results as currently presented were viewed as incomplete.

    2. Reviewer #1 (Public review):

      Summary:

      An ongoing controversy in the field of learning and memory is the specific neural mechanism that maintains long-term memory (LTM). A prominent hypothesis proposed by Sacktor and Fenton and their colleagues is that LTM is maintained by the ongoing activity of the atypical PKC isoform PKMζ. Early evidence in support of this hypothesis came from experiments showing that an inhibitory peptide, ZIP, whose activity was purported to be specific for PKMζ, blocked late-phase hippocampal LTP (L-LTP) and LTM. However, in 2013, two articles reported that LTM was normal in PKMζ knockout mice and that ZIP erased LTM in the knockout mice, indicating that ZIP lacked specificity for PKMζ. In response, Sacktor and Fenton and colleagues reported in 2016 that in PKMζ null mice, there is an increase in the expression of PKC𝜾/λ, a related isoform of atypical PKC, and this increased expression can compensate for PKMζ; their data indicated that the upregulation of PKC 𝜾/λ mediates L-LTP and LTM in the PKMζ. In the present article, the authors provide additional support for this idea. They replicate the finding of an upregulation of PKC 𝜾/λ expression in the hippocampus of PKMζ knockout mice; in addition, they show that the expression of several other PKC isoforms is upregulated in the knockouts. They find that down-regulation of PKC𝜾/λ expression in the hippocampus using the Cre-LoxP technology, the 2016 paper merely used an inhibitor to block the activity of PKC𝜾/λ-blocks L-LTP. Finally, the authors demonstrate that, although LTM is preserved in the single PKMζ knockout mouse, it is eliminated in the PKMζ/PKC𝜾/λ double knockout mouse.

      Strengths:

      The experiments appear to have been carefully executed, the results reliable, and the paper well-written. Overall, the article provides significant additional support for the idea that the activity of PKMζ is critical for the maintenance of hippocampal L-LTP and LTM. The article uses genetic methods, rather than simply pharmacological ones, to demonstrate that when PKMζ is genetically deleted, PKC𝜾/λ, compensates for the missing PKCζ.

      Weaknesses:

      The paper sets up what I believe is probably a false dichotomy between a structural explanation - a change in the number of synaptic connections among neurons - and the persistent kinase activity explanation for memory maintenance. Why are these two explanations necessarily antithetical? It is possible that an increase in synaptic connections and the ongoing activity of PKMζ both contribute substantially to memory maintenance. The authors certainly don't provide any evidence that the number of synapses in the hippocampus remains unchanged after the induction of L-LTP or LTM. Indeed, I see no reason why persistent PKMζ activity could not be a mechanism for the maintenance of an enhanced number of synaptic connections following the induction of LTP/LTM. To the best of my knowledge, this possibility has not yet been explored. Consequently, I don't see why the present results would lead one to favor a biochemical explanation over a structural one for memory maintenance. Given the significant experimental evidence that LTM involves persistent structural changes in neurons, both explanations are equally plausible at present.

    3. Reviewer #2 (Public review):

      Summary:

      The authors are attempting to advance understanding of the role of unconventional PKCs, PKCM𝛇, and PKC𝜄/𝝀 in maintenance of late-phase LTP. Their results help to clarify the interplay between "structural" and "biochemical/enzymatic" mechanisms of LTP and learning in the hippocampus.

      Strengths:

      A strength is the use of conditional knock-outs of PKCM𝛇 and PKC𝜄/𝝀 to assess the role of these two enzymes in maintaining long-term potentiation and in compensating for each other when one of them is conditionally knocked out in the adult.

      Weaknesses:

      The paper is extremely difficult to read because the abstract does not clearly state the advances made over earlier studies by the use of conditional KO mutation. For example, in line nine of the abstract, the authors state, "Here, we found PKC𝜄/𝝀 persists in LTP and long-term memory when PKM𝛇 is genetically deleted." This is confusing because it sounds as though the experiments have repeated earlier published experiments in which the gene encoding PKM𝛇 is deleted in the embryo. The authors are not clear throughout the manuscript that they are using conditional KO of the two enzymes in the adult animal, rather than deletion of the gene. The term "genetically deleted" does not mean "conditionally deleted in the adult." The final sentences of the abstract are: "Whereas deleting PKM𝛇 and PKC𝜄/𝝀 individually induces compensation, deleting both aPKCs abolishes hippocampal late-LTP. Hippocampal 𝜄/𝝀-𝛇 -double-knockout eliminates spatial long-term memory but not short-term memory. Thus, in the absence of PKM𝛇 , a second persistent biochemical process compensates to maintain late-LTP and long-term memory." These sentences do not convey a clear logical conclusion. The Discussion does a better job of stating the importance of the experiments.

    4. Reviewer #3 (Public review):

      Summary:

      The manuscript addresses an important, yet unresolved and long-debated, question: whether atypical protein kinase C is required for the maintenance of late-long-term synaptic potentiation (L-LTP) and long-term memory (LTM). The authors confirm previous findings that persistent activity of PKMζ is required for hippocampal L-LTP and spatial memory. They demonstrate that genetically deleting PKCι/λ and PKMζ individually induces compensatory upregulation, whereas deleting both atypical PKCs abolishes hippocampal L-LTP spatial long-term memory. The study uses an elegant combination of immunoblots, electrophysiology, and behavioral assays. The use of Cre-recombinase to target specific hippocampal regions and neurons adds to the rigor of the findings.

      Strengths:

      The manuscript addresses an important, yet unresolved and long-debated, question; whether PKMζ is required for the maintenance of L-LTP and LTM. The study demonstrates that PKCι/λ, which was previously shown to be critical for the initial generation of the early phase of LTP and short-term memory, becomes persistently active in L-LTP and LTM in a PKMζ knock-out model, compensating for the loss of PKMζ. Furthermore, when the compensation mechanisms are eliminated by simultaneous deletion of both PKMζ and PKCι/λ, maintenance of LTP and long-term spatial memory, but not of short-term memory, is diminished. The strength of this study is that the authors used a double-knockout strategy to directly address the controversy concerning the roles of PKMζ in memory formation. By showing that PKCι/λ compensates when PKMζ is deleted, the authors provided a compelling explanation for previous contradictory findings.

      Weaknesses:

      (1) The authors should provide the numerical values for all data.

      (2) It appears that blind procedures were only used for the behavioral experiments. Some explanation is warranted.

      (3) The description of the immunoblotting procedures lacks sufficient detail. The authors state that immunoblots were stained with multiple antisera to visualize multiple PKCs on the same immunoblot. To conserve antisera, the immunoblots were cut to isolate the relevant proteins based on molecular weight. Isoforms with similar molecular weights were either stained with antisera of different species or on separate blots. Despite this explanation, it is unclear how immunoblotting was performed in practice. For example, in Figure 1B, the authors compared the changes of four conventional PKC isoforms. Because all four antibodies are mouse monoclonal antibodies recognizing proteins of similar molecular weights, each probing should presumably have its own actin loading controls. However, these controls are missing from the figure. Some clarification is warranted.

      (4) The statement in the legend to Figure 4B, that the increases of maximum avoidance time from pretraining to trial 1 are not different, indicates both groups of mice successfully established short-term memory, which is not correct. The analysis only reveals that there is no difference between the two groups. No differences could be due to both groups learning the same, as the authors suggest, or alternatively to no learning in either group.

      (5) The labeling on some of the illustrations (e.g., Figure 2B) is unreadable.

      (6) In Figure 4B, only the single statistical comparison between "pretaining" and "1 trial" is shown. The other comparisons described in the legend should also be illustrated.

      (7) There is no documentation to support the statement that "The prevailing textbook mechanism for how memory is retained asserts that stable structural changes at synapses, the result of initial protein synthesis and growth, sustain memory without the need for ongoing biochemical activity dedicated to storing information" or for the statement in the Discussion that the structural model of memory storage is the standard account.

    5. Author response:

      Thank you for the reviews of our article “PKMζ-PKCι/λ double-knockout demonstrates atypical PKC is crucial for the persistence of hippocampus LTP and spatial memory.” We will address all of the reviewers’ issues point-by-point in a revised version.

    1. eLife Assessment

      This important study implicates that changes in cell regulation may contribute to the evolution of multicellularity. The evidence supporting the conclusions is convincing, with rigorous methods used to test alternative hypotheses. The work will be of broad interest to cell and evolutionary biologists and those studying the cell cycle and cancer.

    2. Reviewer #1 (Public review):

      Summary:

      Ducrocq et al. present research exploring the genetic link between simple multicellular group formation (ace2Δ/ace2Δ) and its interaction with cell-cycle progression mutants (e.g., cln3Δ/cln3Δ), demonstrating that this combination can provide fitness benefits during fluctuating resource conditions, resulting in a rapid increase in the fraction of multicellular cell-cycle mutants over unicellular yeast without selection for multicellular size. Because both the multicellular phenotype and the regulatory link enabling faster escape from the stationary phase are controlled by the Ace2 transcription factor, this work demonstrates that multicellularity can arise as a side-effect of a completely independent fitness advantage unrelated to the benefits of group formation itself. As a "passenger phenotype," multicellularity could thus emerge for other selective reasons, potentially facilitating a later transition to more entrenched multicellularity if novel conditions arise where group formation becomes directly beneficial.

      Strengths:

      This work is novel and exciting for research exploring the very first steps of the transition from unicellularity to simple multicellularity. This is particularly significant because the formation of multicellular groups is almost always assumed to come at a cell-level fitness cost due to reduced reproductive fitness compared to remaining unicellular. This cell-level fitness cost generally needs to be outweighed by the benefits of multicellular group formation (e.g., large size escaping predation) for the multicellular phenotype to be stable, which is true for a large number of cases studied in the literature, where the multicellular phenotype can only evolve over unicellular competitors under strong selection for multicellular groups. However, this study presents an interesting case of a genetic and environmental condition under which individual cells (forming simple multicellular clusters) can actually have higher reproductive fitness than unicellular yeast. This demonstrates that the assumed cost at the single-cell level does not always apply. In summary, this work represents a unique example contrary to common assumptions regarding the costs of multicellular phenotypes, showing that simple multicellular phenotypes can evolve and remain stable without requiring strong selection for multicellular size or other benefits of group formation.

      The claims and interpretation of the results align well with the data presented. This is due to the careful and straightforward experimental design testing predictions with a clear, stepwise methodology, ruling out alternative explanations and providing support for the proposed link between the mutations (ace2, cln3, and others), their impact on faster exit from quiescence, and thus earlier entry into reproduction in fresh media, resulting in higher fitness in the snowflake yeast phenotype compared to unicellular yeast.

      Weaknesses:

      The authors show that the same multicellular phenotype with higher cell-level fitness due to faster exit from the stationary phase can also be observed with alleles found at other loci in non-laboratory yeast strains, implying that the results are likely not specific to a peculiar case genetically engineered in laboratory strains, but that similar phenotypes may be present in nature. However, this remains to be explored further by examining the natural ecology of commercially available or wild yeast isolates and their genomes. This is by no means a weakness of this study and, therefore, not necessarily something the current work can improve. It does mean, however, that the relevance of these findings for early multicellularity in yeast, and even more so for nascent multicellularity in distinct taxa, remains to be explored in the future. Until then, it is difficult to make strong claims about how applicable these results would be for non-laboratory yeast and other taxa. Regardless, this work does its part by representing a very exciting finding.

    3. Reviewer #2 (Public review):

      Summary:

      Here, the authors attempt to demonstrate that a simple model of multicellularity - snowflake yeast - exhibits key ecologically relevant changes in the regulation of the cell cycle. By examining the effects of the ace2 mutation in environments where multicellularity is not directly selected for or against, and combining it with mutations in key cell cycle regulators, they hope to show that mutations driving simple multicellularity can be selectively favored due to their effects on the release from quiescence rather than their effects on multicellularity itself.

      Strengths:

      The experiments performed are extensive and thorough. The yeast genotypes examined are judiciously chosen, so as to map out a functional model of the relationship between alterations to cell cycle control and changes to multicellularity phenotypes. Multiple possible interactions are examined, with the causal link and model of the relationship between the multicellular passenger phenotype and the selectable quiescence-release phenotype being well-supported. There are extensive controls demonstrating the separation between the 'passenger' multicellular phenotype and the cell cycle regulation phenotypes examined, including haploid/diploid strains with different multicellular phenotypes but similar cell cycle regulation phenotypes, and phenocopy strains in which downstream enzymes are deleted rather than key central regulators.

      Weaknesses:

      My only concerns about these results relate to the focus on selection on cell cycle control being examined in a model of multicellularity with key core cell cycle mutations rather than in a wild-type background, as this is a somewhat artificial system.

      I believe, however, that the authors convincingly make their case that this work on the multicellular phenotypes of yeast represents a potent proof-of-concept that simple multicellularity can be driven into existence or selected for as a passenger phenotype due to pleiotropic effects of mutations under selection from real-world ecological pressures. They are able to connect this phenotype back to known mutations of particular cell cycle regulators (RB) in other multicellular lineages and demonstrate that ecologically relevant changes to the cell cycle are connected to multicellular phenotypes. As a proof of concept of the connection between these phenotypes, rather than a study of a particular event in the past of a living lineage, it makes a strong case.

      A longstanding question in the field of multicellularity is the selective pressures that can drive simple multicellularity into existence and then act on simple multicells to drive their increased size and complexity. This work brings to the table tangible evidence of the possibility that, instead of being selected for on its own, simple multicellularity can be a side-effect of selection on other key phenotypes.

      This separates the question of the origins of multicellularity and the forces that drive its further evolution. This separation can reframe how the field is studied, especially in the context of the apparent dichotomy between dozens of origins of 'simple' multicellularity across the tree of life and a few origins of 'complex' multicellularity in the history of Earth. Especially in light of other evidence that multicellularity is connected to changes in cell cycle regulation, I believe that this is an important insight that will alter the way we think about the origins of this key evolutionary transition.

    4. Author response:

      We thank the reviewers for their insightful comments on our work.

      We agree with reviewer #1 that further experiments would be needed to figure out how the observations done on lab strains can apply to yeast in various ecological conditions and particularly in the wild. We here provide a proof of principle that multicellularity selection can arise as a side-effect. It obviously does not prove that it took place during yeast evolution, but we would like to emphasize that resource fluctuations are very common in ecological conditions, making it highly likely that the environmental conditions necessary for the selection of the side effects described have arisen.

      We agree with reviewer #2 that our work on yeast strains is “somewhat artificial” as often the case with model organisms under laboratory conditions. Importantly though, we showed that the effect found with the cln3 knock-out mutation can be phenocopied by overexpression of WHI5 (encoding the yeast equivalent of Rb). We propose that variations in the levels of cell cycle regulators during evolution may have played a role in multicellularity selection as a side effect. We agree that this is merely a hypothesis to explain the selection of multicellularity (just like predator escape) and that there is no direct evidence that this occurred in the history of the lineage. Nevertheless, our work provides a first evidence that such a selection of multicellularity as a side effect could be possible, and gives a framework to understand how multicellularity can persist in the wild, even when it is not the primary target of selection.

      We are currently working on the text and figure revisions suggested by the reviewers.

    1. eLife Assessment

      This study presents valuable findings implicating nuclear export in the regulation of protein condensate behaviour and TDP-43 phase behaviour, suggesting a link to pathogenic aggregation in ALS/FTD. However, the research relies extensively on synthetic, non-physiological protein variants and a homozygous disease model, with limited mechanistic validation, leading to conclusions that remain largely correlative. Furthermore, limitations in the reporting of experimental replication and controls, as well as inconsistencies between cancer cell and neuronal models, diminish confidence in the robustness of the findings. Despite its technical strengths, the findings presented are currently incomplete and do not provide sufficient evidence to substantiate claims about the direct role of nuclear export in pathological protein aggregation and disease.

    2. Reviewer #1 (Public review):

      In this paper, the authors use a doxycycline-inducible DLD1 cell line expressing a Clover-tagged RNA-binding-defective TDP-43 2KQ mutant that forms nuclear "anisosomes" (TDP-43 shell with HSP70 core) to carry out a small-molecule screen using the LOPAC 1280 library to identify compounds that reduce anisosome number or shift their morphology and dynamics. They also conducted a genome-wide siRNA screen to identify genetic modifiers of anisosome formation and dynamics. From these screens, the authors identify pathways in RNA splicing, translation, proteostasis (proteasome and HSP90), and nuclear transport, including XPO1. They then focus on XPO1 as their primary hit. Pharmacological inhibition of XPO1 using KPT-276, Verdinexor, and Leptomycin B reduces anisosome number while enlarging remaining condensates, which retain liquid-like behavior by FRAP and fusion assays. XPO1 overexpression causes fewer, enlarged TDP-43 puncta, including cytoplasmic puncta, with little or no FRAP recovery, interpreted as gel or solid-like aggregates. Anisosome induction reduces detectable nucleoplasmic XPO1 staining. Finally, the authors examine a homozygous TDP-43 K181E iPSC-derived forebrain organoid model, showing increased cytosolic pTDP-43 in K181E/K181E organoids compared to wild-type controls. Chronic low-dose KPT-276 reduces cytoplasmic pTDP-43 without changing total TDP-43 levels. Bulk RNA-seq shows only a modest fraction of dysregulated genes in K181E/K181E organoids are rescued by KPT-276. They conclude that nuclear export, via XPO1, is a key regulator of TDP-43 liquid-to-solid phase transitions and that cytoplasmic aggregation per se may contribute only modestly to TDP-43 proteinopathy, with RNA-processing defects being dominant.

      The study presents well-executed chemical and genome-wide siRNA screens in a DLD1 TDP-43 2KQ anisosome model and follows up on nuclear transport, particularly XPO1, as a modulator of TDP-43 phase behavior and cytoplasmic aggregation. The screens are impressive in scale, and the microscopy and fluorescence recovery after photobleaching (FRAP) work is technically strong. However, the central mechanistic and disease-relevance claims are not yet sufficiently supported. There are major concerns about the heavy reliance on non-physiological, RNA-binding-defective, and acetylation-mimetic TDP-43 (2KQ) and a homozygous TDP-43 K181E organoid model. An underdeveloped and partly contradictory mechanistic link exists between XPO1 and TDP-43 phase transitions in the context of prior work showing TDP-43 is not a canonical XPO1 cargo. The paper also appears to overinterpret organoid data to conclude that cytoplasmic TDP-43 aggregation plays only a minor role in pathology, based largely on pTDP-43 antibody staining with limited sensitivity and relatively modest rescue readouts. A deeper mechanistic analysis and additional, more physiological validation are needed for this to reach the level of rigor and impact implied by the title and abstract. The work feels screen-rich but conceptually underdeveloped, with key claims outpacing the data. A major revision with substantial new data and tempering of conclusions is warranted. I outline several problematic areas below:

      (1) The central mechanistic discoveries are derived almost entirely from a DLD1 colon cancer cell line overexpressing an RNA-binding-defective, acetylation-mimetic TDP-43 2KQ mutant and homozygous TDP-43 K181E iPSC-derived organoids. Both systems are far from physiological. The 2KQ mutation is a synthetic double lysine-to-glutamine mutant originally designed to mimic acetylation and disrupt RNA binding. In this study, essentially all cell-based mechanistic data on phase behavior, screens, and XPO1 effects rely on 2KQ. Yet there is no quantification of how much endogenous TDP-43 is acetylated in degenerating human neurons, nor whether a 2KQ-like acetylation state is ever achieved in vivo. It is not established that the phase behavior of 2KQ recapitulates the physiological or pathological phase behavior of wild-type TDP-43 or genuine disease-linked mutants, which may retain partial RNA binding and different post-translational modification patterns. As a result, it is difficult to know whether the modifiers identified here regulate a highly artificial 2KQ condensate or physiologically relevant TDP-43 condensates. To address this concern, the paper would benefit from quantifying endogenous TDP-43 acetylation at the relevant lysines in control and ALS/FTD patient tissue or more disease-proximal models such as heterozygous TARDBP mutant iPSC neurons, which would justify the focus on an acetyl-mimetic mutant. Key phenomena, including XPO1 dependence of phase behavior, effects of proteasome and HSP90 inhibition, and effects of splicing and translation inhibitors, should be tested for wild-type TDP-43 expressed at near-physiological levels and for one or more bona fide ALS/FTD-linked TARDBP mutants that are not acetyl mimetics. At a minimum, the authors should show that endogenous TDP-43 in neuronally differentiated cells exhibits qualitatively similar responses to XPO1 modulation, rather than exclusively relying on DLD1 2KQ overexpression.

      (2) The organoid model is based on a homozygous K181E knock-in line. However, in patients, TARDBP mutations are overwhelmingly heterozygous. Homozygosity is thus a severe, arguably non-physiological sensitized background that may exaggerate nuclear RNA mis-splicing and phase defects and alter the relative contribution of cytoplasmic aggregation versus nuclear loss-of-function. In addition, it is not fully clear from this manuscript whether the structures in K181E organoids are bona fide anisosomes as defined in Yu et al. 2021, characterized by HSP70-enriched central liquid cores with TDP-43 shells and similar FRAP and fusion behavior to anisosomes in the DLD1 model. At present, the organoid section is framed as validation of "anisosome-bearing organoids," but the figures in this manuscript mainly show pTDP-43 puncta and total TDP-43 immunostaining, without detailed structural or biophysical characterization. The authors should explicitly compare heterozygous K181E/+ organoids or another heterozygous TARDBP mutant line with homozygous K181E/K181E organoids to assess whether XPO1 inhibition has similar effects in a genotype that more closely resembles patient genetics. They should provide direct evidence that the K181E condensates in organoids are anisosomes through HSP70 core immunostaining, three-dimensional reconstruction, and FRAP measurements, and clarify whether KPT-276 is acting on anisosome-like structures or more generic cytoplasmic aggregates or puncta. Without this, the leap from a DLD1 2KQ cancer cell model to human ALS/FTD-relevant neurons is not convincingly supported.

      (3) The title and framing assert that "nuclear export governs TDP-43 phase transitions." However, prior studies such as Pinarbasi et al. 2018 and Duan et al. 2022 indicate that TDP-43 is not a canonical XPO1 cargo and that its export is largely passive, with active nuclear import being the dominant determinant of nuclear localization. The authors cite these studies but still position XPO1 as a central, quasi-direct regulator. The data presented are largely correlative or based on pharmacologic manipulation and overexpression in an overexpression mutant background, with no direct evidence that XPO1 engages TDP-43 in a specific, regulated manner. Even if XPO1 does not engage WT TDP-43, it could still engage the 2KQ variant, which needs to be tested.

      (4) The XPO1 perturbations yield somewhat confusing phenotypes. XPO1 inhibition using Leptomycin B, KPT-276, and Verdinexor reduces anisosome number and enlarges remaining anisosomes, which remain liquid-like by FRAP recovery and fusion assays and stay nuclear. XPO1 overexpression causes fewer, enlarged puncta, but these are FRAP-impaired (gel-like) and redistribute to the cytoplasm. Thus, both decreased and increased XPO1 activity reduce anisosome number and enlarge puncta, but with opposite phase behaviors and subcellular localizations. The model presented in Figure 5L is relatively qualitative and does not resolve these issues. Moreover, XPO1 inhibition globally impairs nuclear export of many cargos and profoundly alters the nuclear environment, transcription, RNA processing, and chromatin. It is therefore difficult to conclude that the observed effects are specific to TDP-43 phase regulation as opposed to secondary consequences of broad nuclear export blockade.

      (5) The authors show that anisosome induction depletes nucleoplasmic XPO1 signal and that mCherry-XPO1 can be seen in some TDP-43 puncta. However, antibody penetration into anisosomes is limited, so XPO1 depletion from nucleoplasm could reflect sequestration in the anisosome shell or core, but this is not demonstrated. There is no demonstration of physical interaction, even indirect interaction, between XPO1 and TDP-43 or a defined adaptor, nor identification of a specific mutant of XPO1 that selectively disrupts this putative interaction while preserving other functions. The known TDP-43 NES has been shown to be weak and not a functional XPO1-dependent NES in multiple studies. If XPO1 is acting through an adaptor that recognizes 2KQ or K181E specifically, that by itself would bring into question the generality of the mechanism for wild-type TDP-43.

      (6) To support a mechanistic claim that nuclear export governs TDP-43 phase transitions, more targeted evidence is needed. The authors should test whether siRNA knockdown or CRISPR interference of XPO1 in the DLD1 2KQ model reproduces the effects seen with Leptomycin B and KPT-276, including FRAP and fusion phenotypes, and verify on-target effects by rescue with an siRNA-resistant XPO1 construct. They should demonstrate that canonical XPO1 cargos behave as expected under the inhibitor conditions used, as a positive control, and that the concentrations used are not grossly toxic. They should attempt to identify or at least constrain candidate adaptors that might enable XPO1-dependent export of TDP-43 through proteomic analysis of XPO1 co-purifying with 2KQ condensates or loss-of-function studies of candidate adaptors from the siRNA screen. Finally, they should test whether a TDP-43 mutant that cannot bind the proposed adaptor still responds to XPO1 manipulation.

      (7) Even with these data, what is currently shown is that global modulation of nuclear export capacity can alter the phase behavior and localization of a highly overexpressed RNA-binding-defective TDP-43 mutant and of K181E in organoids. This is important, but it is weaker than asserting that XPO1 directly governs TDP-43 phase transitions in physiological contexts. The title, abstract, and Discussion should be tempered to reflect that nuclear export is one of several pathways, alongside RNA splicing, translation, and proteostasis, that influence TDP-43 phase states in this model, and that the specific mechanism and cargo relationship between XPO1 and TDP-43 remain unresolved and may be indirect.

      (8) The authors conclude that cytoplasmic TDP-43 aggregation plays only a modest role in TDP-43 proteinopathies because in homozygous K181E organoids, chronic KPT-276 treatment almost abolishes cytoplasmic pTDP-43 puncta, yet bulk RNA-seq shows only a relatively small fraction of dysregulated genes are rescued. There are several issues with this inference. Relying primarily on pTDP-43 antibody staining to define cytoplasmic TDP-43 aggregation is limiting. pTDP-43 antibodies label only phosphorylated species and may miss non-phosphorylated, oligomeric, or amorphous TDP-43 species that could still be toxic. Different pTDP-43 antibodies vary in epitope accessibility depending on aggregate conformation and subcellular location. More sensitive approaches, such as high-affinity TDP-43 RNA aptamer probes developed by Gregory and colleagues, biochemical fractionation for SDS-insoluble and urea-soluble TDP-43, and filter-trap assays, would provide a more quantitative assessment of cytoplasmic aggregation and its reduction by KPT-276. Without these, it is not safe to assume that cytoplasmic aggregation has been eliminated, as opposed to one antigenic subclass.

      (9) The treatment window, spanning from day 87 to 122 with 20 nanomolar KPT-276, may be too late or too mild to reverse entrenched nuclear RNA-processing defects, even if cytoplasmic inclusions are cleared. Once widespread cryptic exon inclusion and alternative polyadenylation misregulation are established, many downstream changes may become self-sustaining or only partially reversible. Moreover, XPO1 inhibition will massively rewire nucleocytoplasmic transport of many transcription factors, splicing factors, and RNA-binding proteins. Thus, the lack of full transcriptomic rescue cannot be cleanly interpreted as evidence that cytoplasmic aggregates are only modest contributors. It may instead reflect that nuclear dysfunction is primary and XPO1 inhibition does not correct, and may even exacerbate, certain nuclear defects.

      (10) To support a causal statement about the modest contribution of cytoplasmic aggregates, one would want more direct measures of neuronal health and function, such as cell death, neurite complexity, synaptic markers, and electrophysiology before and after KPT-276, not only transcriptomics. A way to selectively reduce cytoplasmic aggregation without globally inhibiting nuclear export would allow comparison of outcomes.

      (11) Given these caveats, the concluding statements that cytoplasmic TDP-43 aggregation is only a modest contributor should be substantially softened. A more defensible interpretation is that in this homozygous K181E organoid model, chronic global XPO1 inhibition reduces pTDP-43-positive cytoplasmic puncta but only partially normalizes the steady-state transcriptome, suggesting that persistent nuclear RNA-processing defects and other pathways continue to drive pathology.

      (12) The screens are a major strength but need more rigorous validation for key hits, especially nuclear transport factors. For the siRNA screen, hits are filtered by anisosome number per nucleus, but there is no direct demonstration in the main text that XPO1 or CSE1L knockdown is efficient at the messenger RNA or protein level. For the highlighted genes, Western blot or quantitative polymerase chain reaction validation and phenotypic rescue would strengthen confidence. For small-molecule hits, it is not systematically shown that anisosome modulation is independent of changes in total TDP-43 2KQ expression or gross toxicity. Translation inhibitors are tested for this, but for many other hits, including proteasome, HSP90, and kinase inhibitors, expression and general nuclear structure should be monitored. Given the reliance on anisosome count as a readout, secondary screens that specifically distinguish changes in TDP-43 expression levels, changes in nuclear morphology or cell cycle, and specific changes in anisosome phase behavior, including FRAP and fusion for top hits, would greatly increase interpretability.

      (13) The classification of condensates as liquid versus gel-like or solid is based almost entirely on FRAP recovery or lack thereof. While FRAP is appropriate, interpretations could be made more robust by including half-region-of-interest bleach controls and assessing mobile fractions and recovery kinetics more quantitatively across conditions. Complementing FRAP with other phase-behavior assays such as sensitivity to 1,6-hexanediol, shape relaxation after deformation, and coarsening behavior over longer timescales would strengthen the analysis. At present, some assignments, such as that XPO1 overexpression drives a gel-like transition, are reasonable but somewhat qualitative.

      (14) For the Leptomycin B and KPT-276 experiments in cells and organoids, it would be important to confirm that canonical XPO1 cargo proteins accumulate in the nucleus and that the concentrations used are within a range that is not overtly toxic over the experimental timeframe. Assessing nuclear morphology, chromatin condensation, and general transcriptional activity through global RNA synthesis or key reporter genes would ensure that observed effects are not secondary to severe global nuclear export collapse.

      (15) In the organoid section, it is not clear how many independent iPSC clones and organoid batches were used per condition, nor whether batch effects were assessed in the bulk RNA-seq analysis. This should be fully specified and ideally controlled with isogenic wild-type and K181E clones. For transcriptional rescue, it is important to know whether the changes in wild-type organoids treated with KPT-276 are negligible. A direct wild-type comparison with or without KPT-276 is important to disentangle general drug effects from K181E-specific rescue. More detailed quantification of total TDP-43 and pTDP-43 in both nuclear and cytoplasmic fractions, including biochemical fractionation if possible, would strengthen the assertion that KPT-276 specifically reduces cytosolic pTDP-43 aggregates while sparing nuclear TDP-43.

      (16) Beyond the core issues above, several additions could greatly enhance the impact. The manuscript currently emphasizes XPO1, but the genetic and chemical data clearly implicate RNA splicing, translation, and proteostasis as equally strong or stronger regulators of TDP-43 phase states. A more integrated model that explains how these pathways intersect, for example, how splicing factor availability, ribosome loading, and proteasome capacity co-govern anisosome nucleation, growth, and hardening, would be valuable.

      (17) A key unresolved question is whether XPO1 is acting directly on TDP-43, or instead primarily regulates anisosomes by exporting other factors that more proximally control TDP-43 phase behavior. Given that TDP-43 is not a canonical XPO1 cargo and prior work indicates that its nuclear export is largely passive, it seems at least as plausible that XPO1 inhibition alters the nuclear concentration or localization of splicing factors, RNA-binding proteins, chaperones, or other modifiers identified in the screens, and that changes in these proteins secondarily reshape anisosome dynamics. In other words, XPO1 may be exporting a more direct regulator of anisome formation and hardening, rather than exporting TDP-43 itself in a specific, regulated way. The current data do not distinguish between these possibilities. Systematic identification of XPO1-dependent cargos that colocalize with or biochemically associate with anisosomes, combined with targeted perturbation of their nuclear export, would be needed to determine whether the relevant XPO1 substrate in this system is actually TDP-43 or an upstream modulator of its phase behavior.

      (18) Testing whether identified modifiers converge on nuclear TDP-43 concentration would be informative. Since phase separation is concentration-dependent, measuring nuclear versus cytoplasmic TDP-43 levels across key perturbations, including splicing inhibition, translation inhibition, proteasome inhibition, HSP90 inhibition, and XPO1 modulation, would help determine whether modifiers mainly work by changing nuclear TDP-43 concentration or by altering interaction networks and the material properties of condensates.

      (19) Examining other ALS-relevant RNA-binding proteins would be valuable. Given the role of XPO1 and other hits, it would be informative to briefly test whether similar principles apply to FUS, hnRNPA1, or other ALS-relevant RNA-binding proteins in the same cellular context, to argue for generality versus TDP-43-specific idiosyncrasies of the 2KQ system.

      (20) The Introduction sometimes implies that anisosomes are common and well-established intermediates en route to pathology. It would be helpful to more clearly state that, to date, anisosomes are primarily observed in overexpression and mutant systems and have not yet been unequivocally demonstrated in human patient tissue. The link between PDGFRβ, PAK4, GSK-3β, and YAP and TDP-43 phase dynamics is intriguing but only briefly mentioned. The authors should either expand on this or tone down the emphasis in the Results section.

      (21) In the organoid methods, the authors should consider clarifying whether doxycycline is continuously used, which might alter TDP-43 expression and nuclear transport in a non-negligible way.

      (22) For statistical methods, it would be beneficial to indicate whether multiple-comparison corrections were applied for the many FRAP, anisosome count, and size comparisons beyond DESeq2 internal corrections for RNA-seq.

      (23) Some figure legends could more clearly indicate whether the images shown are single z-planes or maximum intensity projections and how the thresholding for anisosome detection was performed.

      (24) In its current form, the manuscript contains an impressive set of screens and some nicely executed imaging of TDP-43 condensates, highlighting nuclear export among other pathways as a modulator of TDP-43 phase behavior. However, the physiological relevance is undercut by heavy reliance on an acetylation-mimetic, RNA-binding-defective TDP-43 mutant and a homozygous K181E organoid model. The mechanistic link between XPO1 and TDP-43 remains largely inferential and partly at odds with prior work. The conclusion that cytoplasmic TDP-43 aggregation is only a modest contributor to disease is not firmly supported by the available data.

      (25) With substantial additional mechanistic work, particularly around XPO1, rigorous validation in more physiological TDP-43 contexts, more sensitive detection of cytoplasmic TDP-43 aggregates, and a tempering of the central claims, this study could make a meaningful contribution to understanding how nucleocytoplasmic transport and other cellular pathways influence TDP-43 phase transitions and aggregation. The work should be reframed as an important screening study that identifies nuclear export as one among several cellular processes that modulate TDP-43 phase behavior in a model system, rather than as a definitive demonstration that nuclear export governs pathological TDP-43 aggregation in disease.

    3. Reviewer #2 (Public review):

      Summary:

      This manuscript addresses an important and timely question in TDP-43 biology by systematically identifying regulators of TDP-43 anisosome formation, with a particular focus on nuclear export via XPO1. Using a combination of unbiased chemical screening, genetic perturbation, and advanced imaging approaches, the authors propose that inhibition of nuclear export modulates the abundance and biophysical properties of TDP-43 anisosomes. The study is conceptually innovative and has potential relevance for neurodegenerative diseases characterized by TDP-43 pathology. However, significant concerns regarding experimental controls, reporting transparency, and model translatability currently limit the strength of the conclusions and the interpretability of several key findings.

      Strengths:

      (1) The study employs an unbiased, hypothesis-free compound screen to identify regulators of TDP-43 anisosome formation, which is a major strength and reduces confirmation bias.

      (2) The authors combine chemical and genetic screening approaches, providing orthogonal validation of key pathways and increasing confidence in the biological relevance of top hits.

      (3) The focus on biophysical properties of TDP-43 assemblies, assessed through imaging and FRAP, moves beyond simple presence/absence of aggregates and provides mechanistic insight into the biophysical states of TDP-43.

      (4) The use of multiple experimental modalities, including live-cell imaging, FRAP, pharmacological perturbation, and transcriptomic analysis, reflects a technically sophisticated and ambitious study design.

      (5) The authors attempt to extend findings beyond immortalized cancer cell lines by incorporating organoid models, demonstrating awareness of disease relevance and translational importance.

      Overall, the manuscript is clearly written and logically structured, making complex experimental workflows accessible and the central hypotheses easy to follow.

      Weaknesses:

      Despite its strengths, the manuscript has several major limitations that affect data interpretation and confidence in the conclusions.

      (1) Lack of appropriate controls for overexpression experiments:

      A central concern is the absence of proper controls for TDP-43 and XPO1 overexpression. Prior studies (including those cited by the authors, Archbold et al.2018) show that overexpression of WT TDP-43 alone is toxic to neurons. Thus, the experimental system itself may induce anisosome formation independently of the mechanisms under study. Similarly, XPO1 overexpression lacks a suitable control (e.g., mCherry alone or mCherry fused to a protein known to be independent of TDP-43). The near-complete colocalization of XPO1 with TDP-43 anisosomes upon overexpression raises the possibility that these structures reflect non-physiological protein accumulation rather than regulated assemblies.

      2) Insufficient experimental and analytical transparency:

      The manuscript frequently lacks clear reporting of experimental details. In multiple figures, the stated number of independent experiments does not match the number of data points shown, making it difficult to assess statistical validity. Concentrations used in the compound screen are not clearly defined, nor is it stated whether multiple concentrations were tested. It is unclear how many wells, cells, or independent cultures were analyzed. The criteria used to reduce 1,533 screening hits to 211 candidates via STRING analysis are not explained. Knockdown and overexpression efficiencies are not reported.

      (3) RNA-seq concerns:

      The RNA-seq experiments are particularly problematic. The number of biological replicates per condition is not stated, and heatmaps suggest that only one sample per group may have been used, which would preclude statistical analysis. No baseline comparison between WT and mutant TDP-43 is shown. Given that TDP-43 is an RNA-binding protein, splicing analyses would be far more informative than gene expression alone, yet no splicing data are presented. Moreover, nuclear retention of TDP-43 does not preclude nuclear aggregation, which may still impair its splicing function.

      (4) Limited translatability to neuronal biology:

      All anisosome analyses are performed in a cancer cell line, raising concerns about relevance to post-mitotic neurons. While organoids are used as a secondary model, the assays performed do not overlap with those used in cancer cells, making it difficult to assess whether anisosome-related mechanisms are conserved. Neuronal toxicity, a critical outcome given known TDP-43 biology, is not assessed. Prior work has shown that WT TDP-43 overexpression alone is toxic to neurons, yet this is not addressed.

      (5) Conceptual and interpretational gaps:

      The authors quantify anisosome number but also report conditions in which anisosome number decreases while size increases. The biological interpretation of larger anisosomes is not discussed, and whether this reflects improvement or worsening of pathology is unclear. Compounds targeting the same mechanism (e.g., nuclear export inhibition) are inconsistently used across experiments (KPT compounds, verdinexor, leptomycin B), raising concerns about reproducibility. In organoids, the experimental paradigm shifts to long-term treatment (35 days vs. 16 hours), further complicating interpretation.

      (6) Overinterpretation of rescue effects:

      Although the authors state that they aim to test whether nuclear export inhibition rescues neuronal defects, no functional neuronal readouts are provided (e.g., viability, morphology, axon outgrowth, or electrophysiological measures). RNA-seq alone is insufficient to support claims of rescue.

      (7) Finally, the model does not appear to exhibit cytosolic TDP-43 aggregation at baseline. It remains unclear whether longer induction would produce cytosolic gel-like assemblies and whether these would be prevented by nuclear export inhibition. Long-term data are shown only in organoids, yet anisosome formation is not assessed there.

    4. Reviewer #3 (Public review):

      Summary:

      TDP-43 proteinopathy is broadly found in neurodegenerative diseases. This manuscript investigates how nuclear export influences the biophysical properties of TDP-43. The authors use a combination of chemical screening and genome-wide siRNA screening to identify pathways that modulate TDP-43 liquid-to-solid transitions. Overall, the study employs a broad array of approaches and addresses an important question in TDP-43 pathobiology. The identification of nuclear export as a central regulator is compelling and conceptually aligns with the emerging view that TDP-43 nucleocytoplasmic trafficking is a major defect in neurodegeneration.

      Strengths:

      This work integrates chemical and genetic screening to identify novel modifiers. The candidates were validated in both reporter cell lines and iPS-differentiated organoids. The findings support the nucleocytoplasmic transport is important for the biophysical properties of TDP-43.

      Weaknesses:

      The mechanisms underlying the connection between nuclear export and phase transition need further clarification. Broader consequences of XPO1 inhibition are not addressed.

    5. Author response:

      Public Reviews:

      Reviewer #1 (Public review):

      In this paper, the authors use a doxycycline-inducible DLD1 cell line expressing a Clover-tagged RNA-binding-defective TDP-43 2KQ mutant that forms nuclear "anisosomes" (TDP-43 shell with HSP70 core) to carry out a small-molecule screen using the LOPAC 1280 library to identify compounds that reduce anisosome number or shift their morphology and dynamics. They also conducted a genome-wide siRNA screen to identify genetic modifiers of anisosome formation and dynamics. From these screens, the authors identify pathways in RNA splicing, translation, proteostasis (proteasome and HSP90), and nuclear transport, including XPO1. They then focus on XPO1 as their primary hit. Pharmacological inhibition of XPO1 using KPT-276, Verdinexor, and Leptomycin B reduces anisosome number while enlarging remaining condensates, which retain liquid-like behavior by FRAP and fusion assays. XPO1 overexpression causes fewer, enlarged TDP-43 puncta, including cytoplasmic puncta, with little or no FRAP recovery, interpreted as gel or solid-like aggregates. Anisosome induction reduces detectable nucleoplasmic XPO1 staining. Finally, the authors examine a homozygous TDP-43 K181E iPSC-derived forebrain organoid model, showing increased cytosolic pTDP-43 in K181E/K181E organoids compared to wild-type controls. Chronic low-dose KPT-276 reduces cytoplasmic pTDP-43 without changing total TDP-43 levels. Bulk RNA-seq shows only a modest fraction of dysregulated genes in K181E/K181E organoids are rescued by KPT-276. They conclude that nuclear export, via XPO1, is a key regulator of TDP-43 liquid-to-solid phase transitions and that cytoplasmic aggregation per se may contribute only modestly to TDP-43 proteinopathy, with RNA-processing defects being dominant.

      We thank the reviewer for carefully summarizing our study.

      The study presents well-executed chemical and genome-wide siRNA screens in a DLD1 TDP-43 2KQ anisosome model and follows up on nuclear transport, particularly XPO1, as a modulator of TDP-43 phase behavior and cytoplasmic aggregation. The screens are impressive in scale, and the microscopy and fluorescence recovery after photobleaching (FRAP) work is technically strong. However, the central mechanistic and disease-relevance claims are not yet sufficiently supported. There are major concerns about the heavy reliance on non-physiological, RNA-binding-defective, and acetylation-mimetic TDP-43 (2KQ) and a homozygous TDP-43 K181E organoid model. An underdeveloped and partly contradictory mechanistic link exists between XPO1 and TDP-43 phase transitions in the context of prior work showing TDP-43 is not a canonical XPO1 cargo. The paper also appears to overinterpret organoid data to conclude that cytoplasmic TDP-43 aggregation plays only a minor role in pathology, based largely on pTDP-43 antibody staining with limited sensitivity and relatively modest rescue readouts. A deeper mechanistic analysis and additional, more physiological validation are needed for this to reach the level of rigor and impact implied by the title and abstract. The work feels screen-rich but conceptually underdeveloped, with key claims outpacing the data. A major revision with substantial new data and tempering of conclusions is warranted. I outline several problematic areas below:

      (1) The central mechanistic discoveries are derived almost entirely from a DLD1 colon cancer cell line overexpressing an RNA-binding-defective, acetylation-mimetic TDP-43 2KQ mutant and homozygous TDP-43 K181E iPSC-derived organoids. Both systems are far from physiological. The 2KQ mutation is a synthetic double lysine-to-glutamine mutant originally designed to mimic acetylation and disrupt RNA binding. In this study, essentially all cell-based mechanistic data on phase behavior, screens, and XPO1 effects rely on 2KQ. Yet there is no quantification of how much endogenous TDP-43 is acetylated in degenerating human neurons, nor whether a 2KQ-like acetylation state is ever achieved in vivo. It is not established that the phase behavior of 2KQ recapitulates the physiological or pathological phase behavior of wild-type TDP-43 or genuine disease-linked mutants, which may retain partial RNA binding and different post-translational modification patterns. As a result, it is difficult to know whether the modifiers identified here regulate a highly artificial 2KQ condensate or physiologically relevant TDP-43 condensates. To address this concern, the paper would benefit from quantifying endogenous TDP-43 acetylation at the relevant lysines in control and ALS/FTD patient tissue or more disease-proximal models such as heterozygous TARDBP mutant iPSC neurons, which would justify the focus on an acetyl-mimetic mutant. Key phenomena, including XPO1 dependence of phase behavior, effects of proteasome and HSP90 inhibition, and effects of splicing and translation inhibitors, should be tested for wild-type TDP-43 expressed at near-physiological levels and for one or more bona fide ALS/FTD-linked TARDBP mutants that are not acetyl mimetics. At a minimum, the authors should show that endogenous TDP-43 in neuronally differentiated cells exhibits qualitatively similar responses to XPO1 modulation, rather than exclusively relying on DLD1 2KQ overexpression.

      Acetylation of endogenous TDP-43 was reported by several studies. Although it occurs at low levels under normal conditions, TDP-43 acetylation is upregulated under stress conditions (e.g. oxidative stress and proteotoxic stress) (PMID: 25556531; PMID: 28724966). Importantly, Cohen et al. reported the identification of acetylated TDP-43 in ALS patient spinal cord (PMID: 25556531), while Yu et al. showed that endogenous wildtype TDP-43 undergoes demixing when neurons were treated with either a deacetylase inhibitor or proteasome inhibitors (PMID: 33335017). These studies also show that acetylated TDP-43 is defective in RNA binding and more prone to aggregation. Furthermore, ectopic expression of acetylated TDP-43 mimetics in cells and mice induces cellular defects similar to those observed in disease models (PMID: 28724966). Thus, our findings, based on previously established TDP-43 mimetics, should provide valuable information regarding the regulation of TDP-43 phase behavior. We agree with the reviewers that the model used in this study has its limitations, and we will be happy to revise the manuscript to tone down some conclusions, and include more background information to justify the use of TDP-43 acetylation mimetics.

      (2) The organoid model is based on a homozygous K181E knock-in line. However, in patients, TARDBP mutations are overwhelmingly heterozygous. Homozygosity is thus a severe, arguably non-physiological sensitized background that may exaggerate nuclear RNA mis-splicing and phase defects and alter the relative contribution of cytoplasmic aggregation versus nuclear loss-of-function. In addition, it is not fully clear from this manuscript whether the structures in K181E organoids are bona fide anisosomes as defined in Yu et al. 2021, characterized by HSP70-enriched central liquid cores with TDP-43 shells and similar FRAP and fusion behavior to anisosomes in the DLD1 model. At present, the organoid section is framed as validation of "anisosome-bearing organoids," but the figures in this manuscript mainly show pTDP-43 puncta and total TDP-43 immunostaining, without detailed structural or biophysical characterization. The authors should explicitly compare heterozygous K181E/+ organoids or another heterozygous TARDBP mutant line with homozygous K181E/K181E organoids to assess whether XPO1 inhibition has similar effects in a genotype that more closely resembles patient genetics. They should provide direct evidence that the K181E condensates in organoids are anisosomes through HSP70 core immunostaining, three-dimensional reconstruction, and FRAP measurements, and clarify whether KPT-276 is acting on anisosome-like structures or more generic cytoplasmic aggregates or puncta. Without this, the leap from a DLD1 2KQ cancer cell model to human ALS/FTD-relevant neurons is not convincingly supported.

      The reviewer is correct that the use of homozygous K181E organoids generates a homogenous background that is more sensitive for detecting phosphor-TDP43. The goal of the experiment was to test whether XPO1 inhibition mitigates the aggregation of a TDP-43 disease mutant. For this purpose, we believe that our experimental setup is suitable. We agree that we should not extrapolate the result to overemphasize on its disease connections. We will revise the paper to tone down this part.

      Regarding the immunostained signals in K181E organoids, we did not report them as anisosomes. As widely documented in the literature, p-TPD-43 is widely used as a marker of pathological TDP-43 aggregation. P-TDP-43 is enriched in pathological aggregates in human ALS and FTLD patients, colocalized with other aggregation signatures such as ubiquitin and other aggregation prone proteins (PMID: 36008843), and is being used as a diagnostic marker for neurodegeneration (PMID: 31661037). Figure 7A showed that inhibiting nuclear export mitigates the accumulation of p-TDP-43 in mutant tissues. We will revise the subheading and the corresponding text to avoid the confusion.

      (3) The title and framing assert that "nuclear export governs TDP-43 phase transitions." However, prior studies such as Pinarbasi et al. 2018 and Duan et al. 2022 indicate that TDP-43 is not a canonical XPO1 cargo and that its export is largely passive, with active nuclear import being the dominant determinant of nuclear localization. The authors cite these studies but still position XPO1 as a central, quasi-direct regulator. The data presented are largely correlative or based on pharmacologic manipulation and overexpression in an overexpression mutant background, with no direct evidence that XPO1 engages TDP-43 in a specific, regulated manner. Even if XPO1 does not engage WT TDP-43, it could still engage the 2KQ variant, which needs to be tested.

      We did not conclude or imply the regulation of TDP-43 by XPO1 is direct. In fact, we explicatively mentioned on page 8 that the regulation is likely indirect and mediated by other factors. The sentence reads as “Since XPO1 does not bind TDP-43 directly (Pinarbasi et al., 2018), additional factors likely facilitate XPO1-mediated TDP-43 nuclear egression under this condition.” We can revise the part to make it clearer. We will also revise the title and change the framing accordingly. 

      (4) The XPO1 perturbations yield somewhat confusing phenotypes. XPO1 inhibition using Leptomycin B, KPT-276, and Verdinexor reduces anisosome number and enlarges remaining anisosomes, which remain liquid-like by FRAP recovery and fusion assays and stay nuclear. XPO1 overexpression causes fewer, enlarged puncta, but these are FRAP-impaired (gel-like) and redistribute to the cytoplasm. Thus, both decreased and increased XPO1 activity reduce anisosome number and enlarge puncta, but with opposite phase behaviors and subcellular localizations. The model presented in Figure 5L is relatively qualitative and does not resolve these issues. Moreover, XPO1 inhibition globally impairs nuclear export of many cargos and profoundly alters the nuclear environment, transcription, RNA processing, and chromatin. It is therefore difficult to conclude that the observed effects are specific to TDP-43 phase regulation as opposed to secondary consequences of broad nuclear export blockade.

      The reviewer correctly summarizes our data and interpretation: XPO1 loss-of-function and gain-of-function generate opposite phenotypes regarding TDP-43 phase behavior. We agree that additional studies are needed to elucidate the underlying mechanism (e.g. direct or indirect), but we feel that belong to a separate study. We plan to re-test the effect of nuclear export inhibition on the subcellular distribution of WT TDP-43 and the acetylation mimetics. We will also add more discussions about the potential indirect effect of XPO-1 inhibition on TDP-43 phase behavior.

      (5) The authors show that anisosome induction depletes nucleoplasmic XPO1 signal and that mCherry-XPO1 can be seen in some TDP-43 puncta. However, antibody penetration into anisosomes is limited, so XPO1 depletion from nucleoplasm could reflect sequestration in the anisosome shell or core, but this is not demonstrated. There is no demonstration of physical interaction, even indirect interaction, between XPO1 and TDP-43 or a defined adaptor, nor identification of a specific mutant of XPO1 that selectively disrupts this putative interaction while preserving other functions. The known TDP-43 NES has been shown to be weak and not a functional XPO1-dependent NES in multiple studies. If XPO1 is acting through an adaptor that recognizes 2KQ or K181E specifically, that by itself would bring into question the generality of the mechanism for wild-type TDP-43.

      We agree that our observation does not demonstrate an interaction between XPO1 and TDP-43. As mentioned above, we did discuss that the regulation of TDP-43 by XPO1 is likely indirect. We will revise our paper further to separate any speculative statements from the data and narrow our mechanistic claim.

      (6) To support a mechanistic claim that nuclear export governs TDP-43 phase transitions, more targeted evidence is needed. The authors should test whether siRNA knockdown or CRISPR interference of XPO1 in the DLD1 2KQ model reproduces the effects seen with Leptomycin B and KPT-276, including FRAP and fusion phenotypes, and verify on-target effects by rescue with an siRNA-resistant XPO1 construct. They should demonstrate that canonical XPO1 cargos behave as expected under the inhibitor conditions used, as a positive control, and that the concentrations used are not grossly toxic. They should attempt to identify or at least constrain candidate adaptors that might enable XPO1-dependent export of TDP-43 through proteomic analysis of XPO1 co-purifying with 2KQ condensates or loss-of-function studies of candidate adaptors from the siRNA screen. Finally, they should test whether a TDP-43 mutant that cannot bind the proposed adaptor still responds to XPO1 manipulation.

      The anisosome enlargement phenotype upon XPO1 depletion was seen in our siRNA screend, which was identified by machine-based image analyses using 6 distinct siRNAs. This, together with the chemical inhibition experiments, convinced us that the phenotype is specifically caused by XPO1 inactivation.

      When characterizing the effect of XPO1 inhibition on anisosome dynamics, we preferred chemical inhibitor because the effect is acute, and is therefore, less likely to be caused by secondary effects.

      Regarding the inhibitor concentration, a literature survey suggested that 50-200nM of Leptomycin B was commonly used. We chose 200nm to ensure a quick and complete inhibition of XPO1-mediated nuclear export (see Figure 3 in PMID: 9628873). This dose is also well tolerated by our cells, at least during the chosen time window.

      We did not propose any specific adaptor that mediates XPO1 interaction with TDP-43. The identification of such adaptor is out of the scope of this study. We will revise our paper to avoid this confusion.

      (7) Even with these data, what is currently shown is that global modulation of nuclear export capacity can alter the phase behavior and localization of a highly overexpressed RNA-binding-defective TDP-43 mutant and of K181E in organoids. This is important, but it is weaker than asserting that XPO1 directly governs TDP-43 phase transitions in physiological contexts. The title, abstract, and Discussion should be tempered to reflect that nuclear export is one of several pathways, alongside RNA splicing, translation, and proteostasis, that influence TDP-43 phase states in this model, and that the specific mechanism and cargo relationship between XPO1 and TDP-43 remain unresolved and may be indirect.

      We will revise the title, abstract, and discussion to temper the conclusion.

      (8) The authors conclude that cytoplasmic TDP-43 aggregation plays only a modest role in TDP-43 proteinopathies because in homozygous K181E organoids, chronic KPT-276 treatment almost abolishes cytoplasmic pTDP-43 puncta, yet bulk RNA-seq shows only a relatively small fraction of dysregulated genes are rescued. There are several issues with this inference. Relying primarily on pTDP-43 antibody staining to define cytoplasmic TDP-43 aggregation is limiting. pTDP-43 antibodies label only phosphorylated species and may miss non-phosphorylated, oligomeric, or amorphous TDP-43 species that could still be toxic. Different pTDP-43 antibodies vary in epitope accessibility depending on aggregate conformation and subcellular location. More sensitive approaches, such as high-affinity TDP-43 RNA aptamer probes developed by Gregory and colleagues, biochemical fractionation for SDS-insoluble and urea-soluble TDP-43, and filter-trap assays, would provide a more quantitative assessment of cytoplasmic aggregation and its reduction by KPT-276. Without these, it is not safe to assume that cytoplasmic aggregation has been eliminated, as opposed to one antigenic subclass.

      We agree with the reviewer that p-TDP-43 may not represent all aggregate species. However, p-TDP-43 antibodies detect the pathologically validated species most tightly associated with TDP-43 proteinopatheis. In human ALS and FTLD-TDP tissues, cytoplasmic inclusions are strongly immunoreactive for phosphorylated TDP-43 (typically S409/410, as used here). Additionally, p-TDP-43 immunohistochemistry is a routine diagnostic criterion in neuropathology. For these reasons, we believe that the observation that inhibition of XPO1 significantly reduces p-TDP-43 is a very significant finding, as it suggests that an improvement in TDP-43 proteinopathy can be achieved by the inhibition of nuclear transport. We plan to revise the text to better explain the significance of p-TDP-43 staining.

      (9) The treatment window, spanning from day 87 to 122 with 20 nanomolar KPT-276, may be too late or too mild to reverse entrenched nuclear RNA-processing defects, even if cytoplasmic inclusions are cleared. Once widespread cryptic exon inclusion and alternative polyadenylation misregulation are established, many downstream changes may become self-sustaining or only partially reversible. Moreover, XPO1 inhibition will massively rewire nucleocytoplasmic transport of many transcription factors, splicing factors, and RNA-binding proteins. Thus, the lack of full transcriptomic rescue cannot be cleanly interpreted as evidence that cytoplasmic aggregates are only modest contributors. It may instead reflect that nuclear dysfunction is primary and XPO1 inhibition does not correct, and may even exacerbate, certain nuclear defects.

      We agree with the reviewer that the lack of rescue may be caused by technical issues. We will remove the RNAseq data and related texts since it is not essential for our main conclusion.

      (10) To support a causal statement about the modest contribution of cytoplasmic aggregates, one would want more direct measures of neuronal health and function, such as cell death, neurite complexity, synaptic markers, and electrophysiology before and after KPT-276, not only transcriptomics. A way to selectively reduce cytoplasmic aggregation without globally inhibiting nuclear export would allow comparison of outcomes.

      We will remove the discussion regarding the role of cytoplasmic aggregates in disease.

      (11) Given these caveats, the concluding statements that cytoplasmic TDP-43 aggregation is only a modest contributor should be substantially softened. A more defensible interpretation is that in this homozygous K181E organoid model, chronic global XPO1 inhibition reduces pTDP-43-positive cytoplasmic puncta but only partially normalizes the steady-state transcriptome, suggesting that persistent nuclear RNA-processing defects and other pathways continue to drive pathology.

      We agree with the review and will revise this part accordingly.

      (12) The screens are a major strength but need more rigorous validation for key hits, especially nuclear transport factors. For the siRNA screen, hits are filtered by anisosome number per nucleus, but there is no direct demonstration in the main text that XPO1 or CSE1L knockdown is efficient at the messenger RNA or protein level. For the highlighted genes, Western blot or quantitative polymerase chain reaction validation and phenotypic rescue would strengthen confidence. For small-molecule hits, it is not systematically shown that anisosome modulation is independent of changes in total TDP-43 2KQ expression or gross toxicity. Translation inhibitors are tested for this, but for many other hits, including proteasome, HSP90, and kinase inhibitors, expression and general nuclear structure should be monitored. Given the reliance on anisosome count as a readout, secondary screens that specifically distinguish changes in TDP-43 expression levels, changes in nuclear morphology or cell cycle, and specific changes in anisosome phase behavior, including FRAP and fusion for top hits, would greatly increase interpretability.

      For the siRNA screen, each positive hit was confirmed by two rounds of screen with 6 independent siRNAs in total. Although we did not validate the knockdown efficiency due to the large number of hits, we routinely include a positive siRNA control in our study (siRNAdeath), which targets an essential gene. Transfection efficiency was controlled by measuring cell viability after knocking down this essential gene. In addition, the identification of XPO1 as a positive regulator of TDP-43 phase behavior was independently validated by our chemical genetic screens. We feel confident that XPO1 is a key modulator of TDP-43 phase behavior. For chemical treatment experiments, the anisosome fusion phenotypes could be detected as early as 5 h post treatment. Given the short treatment, we do not expect a significant change in protein level or toxicity.

      (13) The classification of condensates as liquid versus gel-like or solid is based almost entirely on FRAP recovery or lack thereof. While FRAP is appropriate, interpretations could be made more robust by including half-region-of-interest bleach controls and assessing mobile fractions and recovery kinetics more quantitatively across conditions. Complementing FRAP with other phase-behavior assays such as sensitivity to 1,6-hexanediol, shape relaxation after deformation, and coarsening behavior over longer timescales would strengthen the analysis. At present, some assignments, such as that XPO1 overexpression drives a gel-like transition, are reasonable but somewhat qualitative.

      In this study, we described two types of condensates formed by TDP-43 2KQ, one characterized previously as nuclear anisosome and the other as cytosolic puncta in XPO1 over-expressing cells. The two can be clearly distinguished by several features including the subcellular localization, shape, and mobility. We feel that our FRAP data clearly segregate these puncta into two distinctive types of assemblies. The difference in fluorescence recovery rate is huge. The proposed half-region-of-interest bleach is technically challenging for small anisosomes under normal conditions. When they were enlarged by Leptomycin B treatment, we did perform both whole anisosome bleach and partial bleach (Figure 5D, I). Both assays demonstrate that TDP-43 in these enlarged anisosomes is highly mobile.

      (14) For the Leptomycin B and KPT-276 experiments in cells and organoids, it would be important to confirm that canonical XPO1 cargo proteins accumulate in the nucleus and that the concentrations used are within a range that is not overtly toxic over the experimental timeframe. Assessing nuclear morphology, chromatin condensation, and general transcriptional activity through global RNA synthesis or key reporter genes would ensure that observed effects are not secondary to severe global nuclear export collapse.

      In Leptomycin B treatment experiments, we carefully chose a dose that was previously validated (see Figure 3 in PMID: 9628873). Based on our DAPI staining, the nuclear morphology appears normal (Figure 5A). Additionally, in cell line-based experiment, the effect of Leptomycin B on anisosomes was detected 6-8 hours post treatment. The change in global protein synthesis should be relatively minor at this time point. In the organoid experiment, the drug dose was determined by a pre-experiment in which the morphology of organoids was evaluated after prolonged treatment with different doses of the inhibitors.

      (15) In the organoid section, it is not clear how many independent iPSC clones and organoid batches were used per condition, nor whether batch effects were assessed in the bulk RNA-seq analysis. This should be fully specified and ideally controlled with isogenic wild-type and K181E clones. For transcriptional rescue, it is important to know whether the changes in wild-type organoids treated with KPT-276 are negligible. A direct wild-type comparison with or without KPT-276 is important to disentangle general drug effects from K181E-specific rescue. More detailed quantification of total TDP-43 and pTDP-43 in both nuclear and cytoplasmic fractions, including biochemical fractionation if possible, would strengthen the assertion that KPT-276 specifically reduces cytosolic pTDP-43 aggregates while sparing nuclear TDP-43.

      The organoid experiment was performed with two batches per condition. This is to reduce the effect of batch variation. The wildtype cells and K181E mutant are derived from the same genetic background. We will revise the text to clarify these issues. Given the cost of this experiment, we did not include drug-treated wild-type as a control. Given the criticisms by review 1 and 2 on the RNAseq data, we will remove this non-essential data from our revision.

      (16) Beyond the core issues above, several additions could greatly enhance the impact. The manuscript currently emphasizes XPO1, but the genetic and chemical data clearly implicate RNA splicing, translation, and proteostasis as equally strong or stronger regulators of TDP-43 phase states. A more integrated model that explains how these pathways intersect, for example, how splicing factor availability, ribosome loading, and proteasome capacity co-govern anisosome nucleation, growth, and hardening, would be valuable.

      We agree with the reviewer that these are important directions for future studies. We will include some discussions on a possible model that integrate these factors.

      (17) A key unresolved question is whether XPO1 is acting directly on TDP-43, or instead primarily regulates anisosomes by exporting other factors that more proximally control TDP-43 phase behavior. Given that TDP-43 is not a canonical XPO1 cargo and prior work indicates that its nuclear export is largely passive, it seems at least as plausible that XPO1 inhibition alters the nuclear concentration or localization of splicing factors, RNA-binding proteins, chaperones, or other modifiers identified in the screens, and that changes in these proteins secondarily reshape anisosome dynamics. In other words, XPO1 may be exporting a more direct regulator of anisome formation and hardening, rather than exporting TDP-43 itself in a specific, regulated way. The current data do not distinguish between these possibilities. Systematic identification of XPO1-dependent cargos that colocalize with or biochemically associate with anisosomes, combined with targeted perturbation of their nuclear export, would be needed to determine whether the relevant XPO1 substrate in this system is actually TDP-43 or an upstream modulator of its phase behavior.

      The reviewer raises an important point. We did include some discussions along this line in our paper. We can add more to further clarify this issue. Again, as mentioned in the original draft, we did not conclude there is an interaction between TDP-43 and XPO1.

      (18) Testing whether identified modifiers converge on nuclear TDP-43 concentration would be informative. Since phase separation is concentration-dependent, measuring nuclear versus cytoplasmic TDP-43 levels across key perturbations, including splicing inhibition, translation inhibition, proteasome inhibition, HSP90 inhibition, and XPO1 modulation, would help determine whether modifiers mainly work by changing nuclear TDP-43 concentration or by altering interaction networks and the material properties of condensates.

      We will measure the nuclear TDP-43 concentration in our imaging experiments and add the data to a revised version.

      (19) Examining other ALS-relevant RNA-binding proteins would be valuable. Given the role of XPO1 and other hits, it would be informative to briefly test whether similar principles apply to FUS, hnRNPA1, or other ALS-relevant RNA-binding proteins in the same cellular context, to argue for generality versus TDP-43-specific idiosyncrasies of the 2KQ system.

      We agree that this is an important issue but we feel the proposed experiments are beyond the scope of the study.

      (20) The Introduction sometimes implies that anisosomes are common and well-established intermediates en route to pathology. It would be helpful to more clearly state that, to date, anisosomes are primarily observed in overexpression and mutant systems and have not yet been unequivocally demonstrated in human patient tissue. The link between PDGFRβ, PAK4, GSK-3β, and YAP and TDP-43 phase dynamics is intriguing but only briefly mentioned. The authors should either expand on this or tone down the emphasis in the Results section.

      We will revise the introduction accordingly.

      (21) In the organoid methods, the authors should consider clarifying whether doxycycline is continuously used, which might alter TDP-43 expression and nuclear transport in a non-negligible way.

      The organoid model does not involve protein overexpression or doxycycline treatment. We measured endogenous p-TDP-43. We will revise to paper to avoid the confusion.

      (22) For statistical methods, it would be beneficial to indicate whether multiple-comparison corrections were applied for the many FRAP, anisosome count, and size comparisons beyond DESeq2 internal corrections for RNA-seq.

      We will add this information to the figure legends during revision.

      (23) Some figure legends could more clearly indicate whether the images shown are single z-planes or maximum intensity projections and how the thresholding for anisosome detection was performed.

      We will revise the figure legends to include this information. As for anisosome detection, because they are so obvious, standard thresholding was sufficient to identify them.

      (24) In its current form, the manuscript contains an impressive set of screens and some nicely executed imaging of TDP-43 condensates, highlighting nuclear export among other pathways as a modulator of TDP-43 phase behavior. However, the physiological relevance is undercut by heavy reliance on an acetylation-mimetic, RNA-binding-defective TDP-43 mutant and a homozygous K181E organoid model. The mechanistic link between XPO1 and TDP-43 remains largely inferential and partly at odds with prior work. The conclusion that cytoplasmic TDP-43 aggregation is only a modest contributor to disease is not firmly supported by the available data.

      We agree with the reviewer that the strength of the study is our unbiased approach that identify pathways capable of modulating TDP-43 phase separation behavior. We will revise our paper to carefully discuss the potential physiological relevance of our study and tone down some mechanistic conclusions, as suggested by the reviewer.

      (25) With substantial additional mechanistic work, particularly around XPO1, rigorous validation in more physiological TDP-43 contexts, more sensitive detection of cytoplasmic TDP-43 aggregates, and a tempering of the central claims, this study could make a meaningful contribution to understanding how nucleocytoplasmic transport and other cellular pathways influence TDP-43 phase transitions and aggregation. The work should be reframed as an important screening study that identifies nuclear export as one among several cellular processes that modulate TDP-43 phase behavior in a model system, rather than as a definitive demonstration that nuclear export governs pathological TDP-43 aggregation in disease.

      We will reframe the study as an important screening study that identifies nuclear export among several other pathways as modulators of TDP-43 phase behavior.

      Reviewer #2 (Public review):

      Summary:

      This manuscript addresses an important and timely question in TDP-43 biology by systematically identifying regulators of TDP-43 anisosome formation, with a particular focus on nuclear export via XPO1. Using a combination of unbiased chemical screening, genetic perturbation, and advanced imaging approaches, the authors propose that inhibition of nuclear export modulates the abundance and biophysical properties of TDP-43 anisosomes. The study is conceptually innovative and has potential relevance for neurodegenerative diseases characterized by TDP-43 pathology. However, significant concerns regarding experimental controls, reporting transparency, and model translatability currently limit the strength of the conclusions and the interpretability of several key findings.

      We thank the reviewer for acknowledging the significance and innovation of our study.

      Strengths:

      (1) The study employs an unbiased, hypothesis-free compound screen to identify regulators of TDP-43 anisosome formation, which is a major strength and reduces confirmation bias.

      (2) The authors combine chemical and genetic screening approaches, providing orthogonal validation of key pathways and increasing confidence in the biological relevance of top hits.

      (3) The focus on biophysical properties of TDP-43 assemblies, assessed through imaging and FRAP, moves beyond simple presence/absence of aggregates and provides mechanistic insight into the biophysical states of TDP-43.

      (4) The use of multiple experimental modalities, including live-cell imaging, FRAP, pharmacological perturbation, and transcriptomic analysis, reflects a technically sophisticated and ambitious study design.

      (5) The authors attempt to extend findings beyond immortalized cancer cell lines by incorporating organoid models, demonstrating awareness of disease relevance and translational importance.

      Overall, the manuscript is clearly written and logically structured, making complex experimental workflows accessible and the central hypotheses easy to follow.

      Weaknesses:

      Despite its strengths, the manuscript has several major limitations that affect data interpretation and confidence in the conclusions.

      (1) Lack of appropriate controls for overexpression experiments:

      A central concern is the absence of proper controls for TDP-43 and XPO1 overexpression. Prior studies (including those cited by the authors, Archbold et al.2018) show that overexpression of WT TDP-43 alone is toxic to neurons. Thus, the experimental system itself may induce anisosome formation independently of the mechanisms under study. Similarly, XPO1 overexpression lacks a suitable control (e.g., mCherry alone or mCherry fused to a protein known to be independent of TDP-43). The near-complete colocalization of XPO1 with TDP-43 anisosomes upon overexpression raises the possibility that these structures reflect non-physiological protein accumulation rather than regulated assemblies.

      As mentioned in our response to reviewer 1, point 1, we will add more discussion regarding the use of acetylation mimetics in our study. We agree with the reviewer that these large puncta (both anisosomes and gel-like structures) likely resulted from TDP-43 overexpression. Nevertheless, in a titration experiment done by Yu et al. 2020 (PMID: 33335017), they showed that ectopic TDP-43 undergo demixing even at concentrations lower than endogenous TDP-43, although the demixed puncta were very small. Their result suggested that overexpression per se does not change TDP-43 phase behavior, only enlarging the demixed TDP-43 structures. This is necessary for our screen and imaging-based characterization. We will revise the text to clarify this point.

      For XPO1, we did include mCherry alone control in the study but due to space limit in Figure 5, we did not include it. We can put the data in a Supplementary Figure during revision.

      (2) Insufficient experimental and analytical transparency:

      The manuscript frequently lacks clear reporting of experimental details. In multiple figures, the stated number of independent experiments does not match the number of data points shown, making it difficult to assess statistical validity. Concentrations used in the compound screen are not clearly defined, nor is it stated whether multiple concentrations were tested. It is unclear how many wells, cells, or independent cultures were analyzed. The criteria used to reduce 1,533 screening hits to 211 candidates via STRING analysis are not explained. Knockdown and overexpression efficiencies are not reported.

      We apologize for these omissions. We will add more experimental details to the figure legends and the method part. For the imaging experiments, data points reflect randomly selected individual cells imaged in 2-3 independent biological repeats. For chemical screens, we screened against NCATS libraries first at top concentration (10 mM) to ensure inhibitory efficacy for all compounds. In the follow-up study, we validated the top hits using a series of concentrations, as shown in Figure 1B.

      We will explain the STRING analysis in more detail. We did not check XPO1 knockdown efficiency in high through-put screens (HTS) for several reasons. Firstly, the large number of positive hits makes it impossible to check knockdown efficiency for all these hits. Secondly, the effect of XPO1 knockdown on anisosomes was seen with 6 different siRNAs in two rounds of screens. Thirdly, in the HTS protocol, we routinely included a transfection control (siRNAdeath) to indicate high transfection efficiency. We would only process the data if siRNAdeath control killed > 90% of the cells.

      (3) RNA-seq concerns:

      The RNA-seq experiments are particularly problematic. The number of biological replicates per condition is not stated, and heatmaps suggest that only one sample per group may have been used, which would preclude statistical analysis. No baseline comparison between WT and mutant TDP-43 is shown. Given that TDP-43 is an RNA-binding protein, splicing analyses would be far more informative than gene expression alone, yet no splicing data are presented. Moreover, nuclear retention of TDP-43 does not preclude nuclear aggregation, which may still impair its splicing function.

      We apologize for the lack of clarity regarding the RNA-seq design. For each condition, organoids of two independently differentiated batches were treated in triplicate. We pooled the organoids of the same treatment from the two batches to reduce the impact of batch variation.

      Given the criticisms from both reviewer 1 and 2 on the limitation of the RNAseq study, we plan to remove this data from the revised manuscript.

      (4) Limited translatability to neuronal biology:

      All anisosome analyses are performed in a cancer cell line, raising concerns about relevance to post-mitotic neurons. While organoids are used as a secondary model, the assays performed do not overlap with those used in cancer cells, making it difficult to assess whether anisosome-related mechanisms are conserved. Neuronal toxicity, a critical outcome given known TDP-43 biology, is not assessed. Prior work has shown that WT TDP-43 overexpression alone is toxic to neurons, yet this is not addressed.

      We agree with the reviewer that the model used in this study is not directly relevant to neurodegeneration. However, as pointed out by the reviewer, neurons are much more sensitive to TDP-43-associated toxicity. By contrast, the cell line used in this study can tolerate TDP-43 overexpression with no detectable cytotoxicity. This feature makes it feasible to evaluate how different cellular processes modulate TDP-43 phase behavior without the confounding effect from toxicity. The fact that TDP-43 expression was induced for a short period of time also help minimize the impact of toxicity. Notably, the processes identified by our screens are all house-keeping pathways that is present in neurons. Thus, we believe that the reported findings are likely applicable to neurons, though we will revise our paper to make sure that we don’t overstate the clinical relevance of our work.

      (5) Conceptual and interpretational gaps:

      The authors quantify anisosome number but also report conditions in which anisosome number decreases while size increases. The biological interpretation of larger anisosomes is not discussed, and whether this reflects improvement or worsening of pathology is unclear. Compounds targeting the same mechanism (e.g., nuclear export inhibition) are inconsistently used across experiments (KPT compounds, verdinexor, leptomycin B), raising concerns about reproducibility. In organoids, the experimental paradigm shifts to long-term treatment (35 days vs. 16 hours), further complicating interpretation.

      As pointed out by the reviewer 1 in point 4 above, we do not have evidence to establish a convincing correlation between the size of anisosomes and clinical phenotypes. Regarding the use of different drugs for different experiments, the initial screen identified KPT and Verdinexor because Leptomycin B was not in our library. In the follow-up studies, we switched to Leptomycin B because 1) it is commercially available; 2) it is highly potent and specific; 3) it was more commonly used as inhibitors of XPO1 according to the literature. However, for the organoid study, we had to switch back to KPT because of the toxicity issue associated with long-term application of Leptomycin B.

      (6) Overinterpretation of rescue effects:

      Although the authors state that they aim to test whether nuclear export inhibition rescues neuronal defects, no functional neuronal readouts are provided (e.g., viability, morphology, axon outgrowth, or electrophysiological measures). RNA-seq alone is insufficient to support claims of rescue.

      Our interpretation of the RNA-seq data was that the rescue effect by nuclear export inhibition was limited and likely insignificant. Given that this negative data is not conclusive, we will remove it from the revised manuscript.

      (7) Finally, the model does not appear to exhibit cytosolic TDP-43 aggregation at baseline. It remains unclear whether longer induction would produce cytosolic gel-like assemblies and whether these would be prevented by nuclear export inhibition. Long-term data are shown only in organoids, yet anisosome formation is not assessed there.

      The expression system used in the study reaches a steady state after 48 h of induction. At this point, we did not observe any gel-like structures. We can clarify this point during revision.

      Reviewer #3 (Public review):

      Summary:

      TDP-43 proteinopathy is broadly found in neurodegenerative diseases. This manuscript investigates how nuclear export influences the biophysical properties of TDP-43. The authors use a combination of chemical screening and genome-wide siRNA screening to identify pathways that modulate TDP-43 liquid-to-solid transitions. Overall, the study employs a broad array of approaches and addresses an important question in TDP-43 pathobiology. The identification of nuclear export as a central regulator is compelling and conceptually aligns with the emerging view that TDP-43 nucleocytoplasmic trafficking is a major defect in neurodegeneration.

      Strengths:

      This work integrates chemical and genetic screening to identify novel modifiers. The candidates were validated in both reporter cell lines and iPS-differentiated organoids. The findings support the nucleocytoplasmic transport is important for the biophysical properties of TDP-43.

      We thank the reviewer for acknowledging the significance and strength of our study.

      Weaknesses:

      The mechanisms underlying the connection between nuclear export and phase transition need further clarification. Broader consequences of XPO1 inhibition are not addressed.

      We agree that our study does not address how nuclear export inhibition affect TDP-43 phase behavior. As discussed in the paper, we proposed that the effect of nuclear export inhibition on TDP-43 phase separation is likely indirect. The most likely scenario is that inhibition of nuclear export changes the nuclear environment over time, which affects TDP-43 phase separation. We have tried to isolate nuclear extracts from control and LMB-treated cells and used mass spec to identify proteins that are differentially present in the nucleus. However, knockdown of the identified top candidates did not abolish LMB-induced phase alteration. Considering our observation that RNA splicing is another modulator of TDP-43 phase behavior, it is possible that it is the combined change of RNA and protein composition in the nucleus that alters TDP-43 phase behavior. However, defining the mechanism would require substantial work that is beyond the scope of the current study.

  2. Feb 2026
    1. Reviewer #1 (Public review):

      I enjoyed reading this long but compelling account of the new (generalised) version of the Hierarchical Gaussian filter (HGF). Effectively, it describes an extension of the HGF to accommodate the influence of latent states on volatility - and vice versa. This paper describes a generalisation that has been made available to the community via the TAPAS software. This contribution will be of special interest to people in computational psychiatry, where the application of the HGF has been the most prevalent.

      I thought the background, motivation, description and illustration of the scheme were excellent. The paper is rather long; however, it serves as a useful technical reference.

      There are two issues that I think the authors need to address.

      (1) The first is the failure to properly relate the current scheme to standard implementations of Bayesian filtering under hierarchical state-space models.

      (2) The second is that whilst the paper is well-written, some of the mathematical notation is cluttered. Furthermore, I think that the authors need to motivate the otherwise overengineered description of the requisite variational message passing and decomposition into update steps.

      I think that the authors can address both of these issues by including a technical section in the introduction, relating the HGF to state-of-the-art in the broader field of Bayesian filtering and predictive coding. They can then explain the benefits of the particular generative model - to which the HGF is committed - by drilling down on the update scheme and its implementation in the remainder of the paper.

      I was underwhelmed by the account of predictive coding and its relationship to Bayesian filtering. I think that the authors should suppress the references to predictive coding in the recent machine learning literature. Rather, the presented narrative should emphasise the fact that predictive coding and Bayesian filtering are the same thing. The authors could then explain where the hierarchical Gaussian filter fits within Bayesian filtering and why its particular form lends itself to the variational updates they subsequently derive.

      The authors could add something like the following to the introduction (accompanying PDF has the equations). There is a summary of what follows in the Wikipedia entry on generalised filtering, in particular, its relationship to predictive coding (https://en.wikipedia.org/wiki/Generalized_filtering).

      Relationship to Existing Work

      Technically, the hierarchical Gaussian filter is a Bayesian filter under a hierarchical state-space model. The most general form of these models can be expressed as stochastic differential or difference equations as follows, c.f., Equation 9 in (Feldman and Friston, 2010):

      This functional form implies a hierarchical decomposition into hierarchical levels (l) that are linked through latent causes (v), with dynamics among latent states (x) at each level. From the perspective of the HGF, the state-dependency of state (z) and observation (e) noise at each level is a key feature. The variance (i.e., inverse precision) of the random fluctuations z is known as volatility, which - in a hierarchical setting - can depend upon latent causes and states at higher levels. The variational inversion of these models - sometimes called variational or generalised filtering - finds a number of important applications: a key example here is dynamic causal modelling, typically in the analysis of imaging timeseries. In this setting, unknown or latent states, parameters and precisions are updated in variational steps by minimising variational free energy (a variational bound on negative log marginal likelihood).

      In engineering, the simplest form of generalised filtering is known as a Kalman filter, in which all the equations are linear, and volatility is assumed to be constant. In neurobiology, there is an intimate relationship between generalised filtering and predictive coding: predictive coding was originally introduced for timeseries analysis and compression of sound files (Elias, 1955). Subsequently, the implicit filtering or compression scheme was considered as a description of neuronal processing in the retina (Srinivasan et al., 1982) and then cortical hierarchies (Mumford, 1992; Rao, 1999; Rao and Ballard, 1999). The formal equivalence between predictive coding and Kalman filtering was noted in (Rao, 1999). Kalman filtering itself was then recognised as a special case of generalised filtering that could be read as predictive coding in the brain (Friston and Kiebel, 2009). The estimation of precision in these predictive coding schemes has been associated with endogenous (Feldman and Friston, 2010) and exogenous (Kanai et al., 2015) attention; i.e., with and without state dependency, respectively. Subsequently, precision estimation or uncertainty quantification has become a key focus in computational psychiatry.

      In machine learning, there have been recent attempts to implement predictive coding via the minimisation of variational free energy under generative models with the functional form of conventional neural networks: e.g., (Millidge et al., 2022; Salvatori et al., 2022). However, much of this work is nascent and does not deal with dynamics or volatility. There is an interesting exception in machine learning, namely, transformer architectures, where the attention heads can be read as implementing a form of Kalman gain, namely, estimating state-dependent precision, e.g., (Buckley and Singh, 2024).

      Within this general setting, the HGF emphasises the importance of precision estimation or uncertainty quantification by committing to a particular functional form for the generative model that can be summarised as follows:

      "We will unpack this form below and show how it leads to a remarkably compact and efficient Bayesian belief updating scheme. We will appeal implicitly to variational message passing on factor graphs (Dauwels, 2007; Friston et al., 2017; Winn and Bishop, 2005) to decompose message passing between nodes and, crucially, within-node computations. These computations furnish a scalable and flexible form of generalised Bayesian filtering. In principle, this scheme inherits all the biological plausibility of belief propagation and variational message passing in cortical hierarchies (Friston et al., 2017)."

      It might be worth the authors [re-]reading the abstracts of the above papers, for a clearer sense of how those in computational neuroscience and state-space modelling (but not machine learning) think about predictive coding and its relationship to Bayesian filtering. They could then go through the manuscript, nuancing your discussion of the intimate relationship between variational Bayes, generalised filtering, predictive coding and hierarchical Gaussian filtering.

    2. eLife Assessment

      This paper describes a valuable extension of the Hierarchical Gaussian Filter (HGF) to accommodate the influence of volatility and value, among others. The authors present convincing evidence that the model can recover the generative structure of simulated data. There is not strong evidence that the new model provides a superior account of existing empirical phenomena, and the HGF could be better embedded in the larger filtering and predictive coding literature. This contribution will be of special interest to people in computational psychiatry, where the application of the hierarchical Gaussian filter has been the most prevalent.

    3. Reviewer #2 (Public review):

      Summary:

      The authors introduce a generalised HGF featuring (1) volatility coupling (rate of change), value coupling (phasic or autoregressive drift) [and 'noise coupling', which is a volatility parent of an outcome state] (2) parameters: volatility coupling κ, tonic volatility ω, value coupling α, tonic drift ρ, {plus minus}auto-regressive drift λ (3) inputs at irregular intervals (but still discrete time steps, unlike continuous time belief evolution in predictive coding) (4) states with multiple parents or parents with multiple child states (5) value parents by default have a volatility parent, and volatility parents have a value parent (or none) (6) linear or non-linear (including ReLU) functions (7) also beliefs can be any exponential family distribution (incl binary, categorical), hence can also model POMDPs

      They describe the 3 steps involved in updating (for both value and volatility): (1) prediction (2) update posterior (entails passing both pwPE and prediction precision from lower to upper node - the latter is not found in other predictive coding schemes) (3) prediction error NB this makes the network modular, so nodes can be added/removed without recomputing all the update equations.

      They give some examples of models working using simulated data: (1) sharing of parent nodes can generalise an update from one context to another (2) sharing of child nodes enables multisensory cue combination (e.g. auditory-visual, or interoceptive-exteroceptive).

      The authors further discuss a potential shortcoming of the HGF - its discretisation of timesteps - which is less naturalistic but nevertheless makes it very amenable to fitting trial-wise experimental data. They propose to extend the HGF to modelling within-step dynamics in future, which could make testable continuous time neuronal predictions.

      Strengths:

      Overall, I think the paper is excellent - it contributes an important extension to a popular modelling tool which substantially increases the number of potential applications. It is well written, and I have almost no criticisms to make.

      Weaknesses:

      The authors state that this generalised HGF will "make it easy to build large networks with considerable hierarchical depth", comparable to neural network architectures. The examples they give are extremely simple; however, it would be good to see a more complex one.

    4. Reviewer #3 (Public review):

      Summary:

      In this paper, Weber and colleagues develop a generalization of the HGF, a widely used modeling tool. The generalization allows coupling between latent variables that was not possible in the original HGF. The resulting inference algorithm invites a predictive coding interpretation. The modular structure allows the construction of complex models out of simpler building blocks.

      Strengths:

      Overall, I think this is a valuable technical contribution, which will have applications to neuroscience, behavior, and psychiatry. It is mathematically rigorous, and the exposition is, for the most part, clear. It also comes with open-source software, so it should be a valuable resource to the modeling community.

      Weaknesses:

      My main concern is that the way that this paper is written will only be accessible and interesting to a niche audience interested in particular kinds of approximate inference schemes. The paper doesn't draw out the implications until the very end, so it's hard for readers to understand the motivation for certain modeling choices. It also requires readers to work through many pages of math before getting to applications. The applications themselves are very abstract.

    1. eLife Assessment

      This important study introduces an experimental approach for studying Drosophila oviposition rhythms and identifies the subset of circadian clock neurons that mediate the circadian control of oviposition. The authors try to resolve a known noisy rhythm and provide convincing evidence by using statistical averaging techniques which help reduce this noise but at the cost of variation across individual rhythms. To this end, including the time series of representative individuals for all genotypes tested would have helped in interpreting some of the results. This paper will be of interest to anyone interested in insect ovarian physiology, circadian biology, and reproductive fitness.

    2. Joint Public review:

      Summary

      Riva et al. introduce a semi-automatic setup for measuring Drosophila melanogaster oviposition rhythms and use it to map the timekeeping function underlying egg laying rhythms to a subset of clock cells. Using a combination of neurogenetic manipulations and referencing the publicly available female hemi-brain connectome dataset, they narrow the critical circuit down to possibly two of the three CRYPTOCHROME expressing lateral-dorsal neurons (LNds). Their findings suggest that different overlapping sets of clock neurons may control different behavioral rhythms in D. melanogaster.

      This work will be of interest to researchers interested in the circadian regulation of oviposition in D. melanogaster (and possibly other insects), a phenomenon which has been left relatively under-explored. The construction of a semi-automated setup which can be made relatively cheaply using available motors and 3D printed molds provides a useful model for obtaining longer records of oviposition activity. The analysis of noisy oviposition timeseries, however, may require revisiting both the methods used for sampling eggs laid per female as well as the analytical tools used to clean up and analyze individual records, because simple averaging can lead to incorrect conclusions regarding the underlying nature of the rhythm.

      Strengths

      Additional experiments were carried out for this revised version of the manuscript that strengthen their original findings. These include: using a dominant negative form of the circadian clock gene, cycle, to disrupt the circadian clock, which provides additional support for the role of CRY+ LNds in generating the circadian rhythm of oviposition; reassessing the functionality of PDF neurons and showing that they seem to be important for maintaining the circadian period of egg laying; using the per01 mutation to show the role of period locus function in the control of the circadian rhythm of oviposition. The authors also point to some potentially interesting connectome data that suggest hypotheses regarding the neuronal circuit linking daily timekeeping to oviposition, which will require further validation in future studies. The videos and pictures demonstrate the working of the semi-automated egg collection setup, which should help others create similar devices.

      Weaknesses:

      The major weaknesses of this work result from the noisy nature of the data.

      They include:

      (1) Problems associated with averaging: The authors intended to focus on the oviposition clock in individual females, however due to the inherent noise in the oviposition rhythm they had to resort to averaging across Lomb-Scargle periodograms generated from individual time-series. They then tested whether the averaged periodogram contains a significant frequency. However, this reduction in noise also reduces the ability to compare differences in power of the rhythm across individuals. Furthermore, this method makes it especially difficult to distinguish the contribution of subsets of the circuit on the proportion of rhythmic flies and the power of the rhythm. In this revised version the authors use two manipulations to disrupt the molecular clock, which could have different success rates based on the type and number of cells targeted. Unfortunately, the type of averaging used prevents the detection of any such effects. It is to be noted that, indeed, individual-level differences in period between the PdfDicer-Gal4 > perRNAi and UAS-perRNAi lines help the authors to establish that there is a significant reduction in period length when the molecular clock is abolished in PDF cells. These individual measurements are now very helpful in discerning the effect of manipulations carried out on different circadian neural subsets, some of which could have been missed if only averages were considered.

      (2) Sensitivity to sample size: Averaging reduces the effect of random background noise but noise reduction is dependent upon sample size. Comparing genotypes with different sample sizes in addition to varying signal to noise ratios (which might also change with neural manipulations) makes it difficult to estimate how much of the rhythm structure is contributed by a given neuronal subset; thus, whenever possible comparisons should be made between groups that include similar number of flies. This problem is compounded when the averaged periodogram is composed of both rhythmic and weakly rhythmic individuals. For instance, in the main text the reported value of period length of pdfDicer-Gal4 > perRNAi is 20.74h (see also Fig 2J) but in the Supplementary figure 2S1 this is close to 22h, while the values reported for the control are largely similar (24.35h in Fig 2H versus ~24h in Fig 2S1). A difference of 3.6h between control and experimental flies is much greater than 2h. Which estimate (average versus individual) is more reliable in predicting the behavior of these flies is difficult to determine without further experiments.

      (3) Based on the newly provided data for individual fly periodograms the reader can visually evaluate the rhythmicity associated with each genotype. Such visual inspection did not reveal any clear difference between the proportion of rhythmic individuals between experimental and parental GAL4 and/or UAS controls, except for experiments using per01 mutant animals. This is surprising since if these circuits are controlling the oviposition rhythm, perturbing them should affect most individuals in a similar way.

      In summary, although the authors have implicated CRY+ LNds in the generation of a circadian rhythm in oviposition it is not clear looking at individual readouts if this manipulation is rendering flies arrhythmic or changing the period of the clock slightly, such that there is increased variation in period length at the individual level which is not being captured by the low signal to noise ratio and in the average gives a flattened output as a result. Thus, while the manipulations done to the clock in these neurons might indeed affect the circadian nature of the oviposition rhythm it is still rather difficult to determine if they are indeed the sole clock cells generating this rhythm especially when nearby PDF+ cells also affect period length. Nevertheless, the connectomic data do show that they are very close to the OviIN neurons, placing them at an important juncture of transmitting circadian time information to the downstream oviposition circuit. Overall, the authors have achieved some of their aims, although the analysis methods leave some of their inferences open to speculation.

      Other comments

      Disrupting the clock in the 5th sLNv and 3 Cry+ LNds (and weakly in a small subset of DN1) affected egg-laying. Although the work emphasizes the importance of the LNd, the role of the 5th sLNv's role should be discussed.

    3. Author response:

      The following is the authors’ response to the original reviews.

      Joint Public review:

      Weaknesses:

      (1) Controls for the genetic background are incomplete, leaving open the possibility that the observed oviposition timing defects may be due to targeted knockdown of the period (per) gene but from the GAL4, Gal80, and UAS transgenes themselves. To resolve this issue the authors should determine the egg-laying rhythms of the relevant controls (GAL4/+, UAS-RNAi/+, etc); this only needs to be done for those genotypes that produced an arrhythmic egg-laying rhythm.

      (2) Reliance on a single genetic tool to generate targeted disruption of clock function leaves the study vulnerable to associated false positive and false negative effects: a) The per RNAi transgene used may only cause partial knockdown of gene function, as suggested by the persistent rhythmicity observed when per RNAi was targeted to all clock neurons. This could indicate that the results in Fig 2C-H underestimate the phenotypes of targeted disruption of clock function. b) Use of a single per RNAi transgene makes it difficult to rule out that off-target effects contributed significantly to the observed phenotypes. We suggest that the authors repeat the critical experiments using a separate UAS-RNAi line (for period or for a different clock gene), or, better yet, use the dominant negative UAS-cycle transgene produced by the Hardin lab (https://doi.org/10.1038/22566).

      We have followed the referee advice,repeating the experiments with the dominant negative UAS-cyc<sup>DN</sup>. They nicely confirm our conclusions: the abolition of the cellular clock in LNd neurons rule out the rhythmicity of oviposition. The results are presented in Fig. 3 of the new manuscript, panels H to N. We thank the reviewer for this suggestion that has definitely improved our paper, since it allows us to confirm our result using both a different driver and a different UAS sequence. In addition, we included the required GAL4 controls, which can be found in Panels E, L of the figure as well as average egglaying profiles for all genotypes involved (Panels B, D, F, I, K and M). Regarding the MB122Bsplit-Gal4>UAS-per<sup>RNAi</sup> experiment, we moved it to a supplementary figure (Figure 3S1). The paragraph where the new Figure 3 is discussed has been modified accordingly.

      (3) The egg-laying profiles obtained show clear damping/decaying trends which necessitates careful trend removal from the data to make any sense of the rhythm. Further, the detrending approach used by the authors is not tested for artifacts introduced by the 24h moving average used.

      The method used for the assessment of rhythmicity is now more fully explained and tested in the supplementary material. In particular, the issue of trend removal is treated in the second section of the SM, and the absence of "artifacts" (interpreted as the possibility of deciding that a signal is rhythmic when it is not, or vice versa) shown in figs. S3 to S5.

      (4) According to the authors the oviposition device cannot sample at a resolution finer than 4 hours, which will compel any experimenter to record egg laying for longer durations to have a suitably long time series which could be useful for circadian analyses.

      The choice of sampling every 4 hours is not due to a limitation imposed by the device used. In fact the device can be programmed to move at whatever times are desired. As mentioned in the Material and Methods section, "more frequent sampling gives rise to less consistent rhythmic patterns", because the number of eggs sampled at each time slot become too small. In particular, we have tested sampling at intervals of 2 hours, and we have observed that this doubles the work performed by the experimenter but does not lead to an improvement in the assessment of rhythmicity.

      (5) Despite reducing the interference caused by manually measuring egg-laying, the rhythm does not improve the signal quality such that enough individual rhythmic flies could be included in the analysis methods used. The authors devise a workaround by combining both strongly and weakly rhythmic (LSpower > 0.2 but less than LSpower at p < 0.05) data series into an averaged time series, which is then tested for the presence of a 16-32h "circadian" rhythm. This approach loses valuable information about the phase and period present in the individual mated females, and instead assumes that all flies have a similar period and phase in their "signal" component while the distribution of the "noise" component varies amongst them. This assumption has not yet been tested rigorously and the evidence suggests a lot more variability in the inter-fly period for the egg-laying rhythm.

      As stressed in the paper, and in the new Supplementary Material, the individual egg records are very noisy, which in general precludes the extraction of any information about the underlying period and phase. The workaround we (and others, e.g. Howlader et al. 2006) have used is analyzing average egg records for each genotype. Even though this implies assuming the same period and phase for all individuals, we have observed, using experiments with synthetic data, that small variations in individual periods (of the same amount as those present in real experiments where the period of some flies can be assessed individually) still allow us to use our method to decide if the genotype is rhythmic or not. This issue is discussed at length in the new Supplementary Material. There we also discuss an experiment with real flies, showing the individual records, and the corresponding periodograms, for each fly, for a rhythmic (Fig. S14) and an arrhythmic genotype (Fig. S17).

      (6) This variability could also depend on the genotype being tested, as the authors themselves observe between their Canton-S and YW wild-type controls for which their egg-laying profiles show clearly different dynamics. Interestingly, the averaged records for these genotypes are not distinguishable but are reflected in the different proportions of rhythmic flies observed. Unfortunately, the authors also do not provide further data on these averaged profiles, as they did for the wild-type controls in Figure 1, when they discuss their clock circuit manipulations using perRNAi. These profiles could have been included in Supplementary figures, where they would have helped the reader decide for themselves what might have been the reason for the loss of power in the LS periodogram for some of these experimental lines.

      We have added the individual periodograms of the arrhythmic lines to the Supplementary material (Figs. 3S2, 3S5 and panel G of Fig. 3S1), where they can be compared with their respective controls (Figs 3S3, 3S4, 3S6, 3S7 and panel F of Fig. 3S1).

      (7) By selecting 'the best egg layers' for inclusion in the oviposition analyses an inadvertent bias may be introduced and the results of the assays may not be representative of the whole population.

      We agree that the results may be biased for 'the best egg layers'. We remark however, that the flies that have been left out lay very few eggs, some of them even laying no eggs on a whole day. For these flies it is difficult to understand how one can even speak of egg laying rhythmicity (let alone how one can experimentally assess it). Thus, we think it might be misleading to speak of results as "representative of the whole population". Furthermore, it is even possible that the very concept of egg laying rhythmicity makes little sense if flies do not lay enough eggs.

      (8) An approach that measures rhythmicity for groups of individual records rather than separate individual records is vulnerable to outliers in the data, such as the inclusion of a single anomalous individual record. Additionally, the number of individual records that are included in a group may become a somewhat arbitrary determinant for the observed level of rhythmicity. Therefore, the experimental data used to map the clock neurons responsible for oviposition rhythms would be more convincing if presented alongside individual fly statistics, in the same format as used for Figure 1.

      In general, we have checked that there are no "outliers", in the sense of flies that lay many more eggs than the others in the experiment. But maybe the reviewer is referring to the possibility that a few rhythmic flies make the average rhythmic. This issue is addressed in the supplementary material, at the end of section "Example of rhythmicity assessment for a synthetic experiment". In short, we found that eliminating some of the most rhythmic flies from a rhythmic population makes the average a bit less rhythmic, but still significantly so. Conversely, if these flies are transferred to an arrhythmic population, the average is still non rhythmic.

      Regarding "the number of individual records that are included in a group may become a somewhat arbitrary determinant for the observed level of rhythmicity", we stress that we have not performed a selection of flies for the averages. All of the flies tested are included in the average, independently of their individual rhythmicity, provided only that they lay enough eggs.

      (9) The features in the experimental periodogram data in Figures 3B and D are consistent with weakened complex rhythmicity rather than arrhythmicity. The inclusion of more individual records in the groups might have provided the added statistical power to demonstrate this. Graphs similar to those in 1G and 1I, might have better illustrated qualitative and quantitative aspects of the oviposition rhythms upon per knockdown via MB122B and Mai179; Pdf-Gal80.

      We are aware that in the studies of the rhythmicity of locomotor activity the presence of two significant peaks is usually interpreted as a “complex rhythm”, i.e. as evidence of the existence of two different mechanisms producing two different rhythms in the same individual. In our case, since the periodograms we show assess the rhythmicity of the average time series of several individuals, the two non-significant peaks could also correspond to the periods of two different subpopulations of individuals. However, a close examination of the individual periodograms, now provided as Supplementary Figures 3S2 to 3S9, does not show any convincing evidence of any of these two possibilities.

      Another possibility could be that such peaks are simply an artifact of the method in the analysis of time series that consist of very few cycles and also few points per cycle. In the supplemenatry material we show that this can indeed happen. Consider, for example, periodograms 2 and 4 in Fig. S12 of the SM. Even though both of them display two non significant peaks, these periodograms correspond to two synthetic time series that are completely arrhythmic.

      We have added to the manuscript a paragraph discussing the issue of possible bimodality (next to last paragraph in subsection "The molecular clock in Cry+ LNd neurons is necessary for rhythmic egg-laying").

      Wider context:

      The study of the neural basis of oviposition rhythms in Drosophila melanogaster can serve as a model for the analogous mechanisms in other animals. In particular, research in this area can have wider implications for the management of insects with societal impact such as pests, disease vectors, and pollinators. One key aspect of D. melanogaster oviposition that is not addressed here is its strong social modulation (see Bailly et al.. Curr Biol 33:2865-2877.e4. doi:10.1016/j.cub.2023.05.074). It is plausible that most natural oviposition events do not involve isolated individuals, but rather groups of flies. As oviposition is encouraged by aggregation pheromones (e.g., Dumenil et al., J Chem Ecol 2016 https://link.springer.com/article/10.1007/s10886-016-0681-3) its propensity changes upon the pre-conditioning of the oviposition substrates, which is a complication in assays of oviposition rhythms that periodically move the flies to fresh substrate.

      We agree that social modulation can be important for oviposition, as has been shown in the paper cited by the reviewer. But we think that, in order to understand the contribution of social modulation to oviposition, it is important to know, as a reference for comparisons, what the flies do when they are isolated. Our aim in this work has been to provide such a reference.

      Recommendations for the authors:

      (1) The weaknesses identified in the Public review could be addressed as follows: etc.

      We have followed the suggestions of the editor and addressed each of the weaknesses mentioned (see details above).

      (2) Could the authors comment on their choice of using individual flies for their assay rather than (small) groups of flies? Is it possible that their assay would produce less noisy results with the latter?

      First we want to emphasize that our aim here was to assess the presence of individual rhythmicity, free from any external influences, whether arising from environmental external cues (such as light or temperature changes) or by social interactions (with other females or males). However, we were also curious about the behavior when males were put in the same chamber with each female. We performed a few tests and the results were very similar to what we obtained with single females.

      (3) Minor points:

      (a) Line 57-58 - "around 24 h and a peak near night onset (Manjunatha et al., 2008). Egglaying rhythmicity is temperature-compensated and remains invariant despite the nutritional state": Rephrase to something simpler like temperature and nutrition compensated.

      Corrected.

      (b) Line 56-57 - "The circadian nature of this behavior was revealed by its persistence under DD with a period around 24 h and a peak near night onset (Manjunatha et al., 2008)." A better reference here would be to Sheeba et al, 2001 for preliminary investigations into the egg-laying rhythms of individual flies and McCabe and Birley, 1998 for groups of flies under LD12:12 and DD.

      Suggestion accepted.

      (c) Line 65-67 - "We determined..... molecular clock in the entire clock network reduced the LNv did not." This suggests that it was unknown until now that LNv does not have a role, whereas Howlader et al 2006 already suggested that. The reader becomes aware of this at a later part of the manuscript. Please revise.

      This has been revised, and the citation to Howlader et al 2006 added to the new sentence.

      (d) Line 67 - "impairing the molecular clock in the entire clock network reduced the circadian rhythm of.."; saying "Reduced the power of the circadian rhythm" might be better phrasing."

      Suggestion accepted.

      (e) Line 72 - using the Janelia hemibrain dataset.

      Corrected

      (f) Line 72 typo "ussing", should be 'using'.

      Corrected.

      (g) Line 94: why is the periodic signal the same for all on the first day of DD?

      It is well known that in LD conditions activity is driven by the environmental light-dark cycle, which entrains the endogenous circadian clock of all flies. Even after the transition to DD, the effects of this entrainment persist for a few days, allowing the individual rhythmic patterns set by the light-dark cycle to remain synchronized for at least a few cycles. We are assuming that the same happens with oviposition. A sentence has been added explaining this (beginning of third paragraph of subsection "Egg-laying is rhythmic when registered with a semiautomated egg collection device").

      (h) Figure 1A-D, Were all flies included or only rhythmic flies? Please make this clear. How do you distinguish rhythmic and arrhythmic flies in Figure 1E? Their representative individual plots of egg number graphs are required. Why was the number of flies under DD decreased from 20 to 18?

      Throughout the paper, the analysis of average rhythmicity has been performed including all flies, since we postulate that even flies that individually can be classified as non rhythmic have a rhythm that is corrupted by noise, and that this noise can be partially subtracted by performing an average. The explanation of the characterization of rhythmic and arrhythmic individuals is in the Methods section, under the Data Analysis subsection. This is now fully developed in the Supplementary material, where the individual plots for some of the genotypes are included.

      Regarding the question of the number of flies having "decreased from 20 to 18?", there is a misunderstanding here. The results depicted in Figure 1, and in particular in panel E, correspond to two different experiments: one performed only in LD (7 days, n=20), and a second one performed for 5 days in DD, with one previous day in LD (n=18).

      (i) Figure E and K, Are n=20, 18, and n=30, 22 the total numbers of flies including both rhythmic and nonrhythmic? If so, it would be better to put them in the column, not in the rhythmic column.

      The figure has been corrected.

      (j) Line 107-108, please provide a citation for this statement.

      We have added two references: Shindey et al. 2016, and Deppisch et al. 2022.

      (k) Figure 1, 2, etc., please write a peak value inside the periodogram graph. This makes comparison easier.

      The peak values have been added in all Figures.

      (l) Line 184-185, Figure 2F, tau appears shorter in Clk4.1>perRNAi flies than in control, which suggests that DNp1 may play a role?

      As explained in the Supplementary Material, the particularities of oviposition records (discrete values, noise, few samples per period, etc.) preclude an accurate determination of the period if the record is considered as rhythmic. In particular, Fig. S4 shows that differences of 1 hour between the real and the estimated periods are not unusual.

      (m) Figure 4. Why are 2 controls shown? Please explain. Are they the same strains?

      The two controls shown are the UAS control and the GAL4 control. This information has now been added to the figure.

      (n) Line 314 'that' should be 'than'?

      Corrected.

      (o) Line 73-74 - Phrasing is not clear in: "LNds and oviposition neurons, consisting with, the essential role of LNds neurons in the control of this behavior.""

      Corrected.

      (p) Line 81-84 - "the experiments particularly demanding and labor-intensive. In this approach, eggs are typically collected every 4 hours (sometimes also every 2 hours), which usually implies transferring the fly to a new vial or extracting the food with the eggs and replacing it with fresh food in the same vial (McCabe and Birley, 1998; Menon et al., 2014)." McCabe and Birley had an automated egg collection device designed for groups of flies, which sampled eggs laid every hour for 6 days. Please remove this reference in this context

      Reference removed.

      (q) Line 91-92 - "The assessment of oviposition rhythmicity is challenging because the decision of laying an egg relies on many different internal and external factors making this behavior very noisy." This sentence makes it appear that 'assessment' is the limitation. Even locomotor activity is governed by many internal and external factors, yet we can obtain very robust rhythms. The sentence that follows is also not easy to digest. Can the authors frame the idea better?

      We have rewritten the corresponding paragraph in order to make it more clear (second paragraph of the Results section). Additionally, the Supplementary Material contains now a more detailed explanation and analysis of the method used.

      (r) Line 104-107 - rhythmic (with a period close to 24 h, Figure 1F) although the average egg record is strongly rhythmic with a period around 24 h (Figure 1B). Under DD condition, individual rhythmicity percentages are the same as in LD (Figure 1E) and their average record is also very rhythmic with a period of 24 h (Figure 1D). 'Strongly rhythmic' and 'very rhythmic' are less indicative of what is happening with the oviposition rhythm and can be phrased as robust instead, with a focus on their power measured.

      We have accepted the suggestion.

      (s) Line 108-110 - "Thus, egg-laying displays a much larger variability than locomotor activity, compounding the difficulty of observing the influence of the circadian clock on this behavior." The section discussed here does not illustrate the variability in egg-laying as much as the lack of robustness of the rhythm. The variation in rhythmicity going from CS flies (~70% rhythmic) to yw flies (~50% rhythmic) showcases the variability in this rhythm and how it is difficult to observe when compared to locomotor rhythms, which are usually consistently >90% rhythmic across multiple genotypes. These lines can be placed after the discussion about yw and perS flies. Moreover, previous studies using individual flies have reported that egg-laying rhythm is more variable than others Figure 1, Sheeba et al 2001.

      We have accepted the suggestion, replacing "Thus, egg-laying displays a much larger variability than locomotor activity..." by "This shows that, at the individual level, egg-laying is much less robust than locomotor activity ..."

      (t) Figure 1. Genotype notation within the figure panels is not consistent with the accepted / conventional notation or with the main text or legend notations throughout the manuscript.

      We are sorry for this mistake. We have corrected the genotype names in Figures and text in order to make notation consistent across the paper.

      (u) Supplementary Figure 1 Legend. Error in upper right corner? Not left corner? The photo does not clearly show the apparatus. The authors may wish to consider clearer images and more details about the apparatus including details of the 3D printing of the device and perhaps even include a short video where the motor moves the flies to a new chamber (This is only a suggestion to advertise the apparatus, not related to the review of the manuscript). They could also provide information about what fraction of females survived till the end of each trial when 21 flies were examined with 4-hour sampling across 4-5 cycles.

      In general, more than 80% of the females are alive at the end of a one week oviposition experiment. We have added this information in the Methods section at the end of the corresponding subsection ("Automated egg collection device"). Regarding the eggcollection device, we have replaced the photographs in what is now Supplementary Figure 1S1, and a short supplementary movie showing its operation.

      (v) The results depicted in Figure 2B are that of averaged time series. Hence the reader does not know 'the fact' that knocked-down animals are not completely rhythmic. Is the "not completely arrhythmic" in reference to flies with a power > 0.2 (weakly rhythmic) in their egg-laying rhythm or to the presence of ~40% of male flies (Supplementary Table 1) with a locomotor rhythm after perRNAi silencing of most of their clock neurons? This is confusing because no intermediate category of flies is discussed in Figure 2. Please edit for clarity.

      We were referring to the rhythmicity of the genotype, not of the individuals. We have rewritten the corresponding paragraph in order to make it clearer (last paragraph of the first subsection of the Results section).

      (w) Line 173 - ablation or electrically silencing all PDF+ neurons (Howlader et al., 2006). There were no experiments carried out using electrical silencing of PDF+ neurons in the referenced paper.

      We are sorry for this mistake. This has been corrected (we have deleted the mention to electrical silencing).

      (x) Line 173 - Shortening of period by nearly 3 hours cannot be considered minor.

      We agree, and we have deleted the word "minor".

      (y) Line 332-333 - "We also disrupted the molecular clock (or electrically silenced) in PDFexpressing neurons as well as in the DN1p group with no apparent effect on egg-laying rhythms". There was period shortening observed for pdf GAL4 > perRNAi manipulation so there was an effect on the egg-laying rhythm. Additionally, perRNAi based silencing does not electrically silence PDF neurons as the kir 2.1 was expressed only using Clk4.1 GAL4 in the Dn1ps. This line should be rewritten.

      We have rewritten the paragraph mentioned (third paragraph of the Discussion) in order to make it more accurate.

      (4) Page 22 - Data Analysis

      Since the number of eggs laid by a mated female tend to show a downward trend, we proceeded as follows, in order to detrend the data (see the Supplementary Material for further details). First, a moving average of the data is performed, with a 6 point window, and a new time series T is obtained. In principle, T is a good approximation to the trend of the data. Then, a new, detrended, time series D is generated by pointwise dividing the two series (i.e. D(i)=E(i)/T(i), where i indexes the points of each series)." Can the authors provide a reference for this method of detrending? Smoothing can frequently introduce artifacts in the data and give incorrect period estimates. Additionally, the trend visible in the data, especially in Figure 1, suggests a linear decay that can be easily subtracted. Also, there is no discussion of detrending in the Supplementary material attached.

      We are sorry for the confusion with the Supplementary materials. The method used for subtracting both noise and trend from the data is now fully explained in the new Supplementary Material. All the issues raised by the reviewer in this comment have been addressed there.

      (5) Figure by figure

      Page - Type (Figure or text) - Comment

      (a) Page 6 Figure 1C There is remarkable phase coherence seen in the average egg laying time series for CS flies 5 days into DD and as the authors note in Lines 94-95 in the text "Under light-dark (LD) conditions, or in the first days of DD, it can be that the periodic signal is the same for all flies". Since this observation is crucial to constructing the figures seen later in the paper, a note should be made about why this rhythm could persist across flies, so deep into DD.

      As mentioned above, we have added a couple of lines explaining why we think that the assumption of a synchronized periodic signal is reasonable, at least during the first cycles (second paragraph of the first subsection of section Results).

      (b) Figure 1 G The effect of period/phase decoherence seems to be showing up here in the average profile for yw flies as they seem to completely dampen out after 2 days in DD and yet have a 24-hour rhythm in the averaged periodogram. The authors should make a note here if the LS periodogram is over-representing the periodicity of the first few days in DD or if comparing the first 3 vs. the last 3 days in DD gives different results.

      The dampening observed in average oviposition records is a product of the dampening of the oviposition records, which is well known phenomenon, probably caused by the depletion of sperm in the female spermatheque. One of the aims of the method used in the paper was to avoid the bias introduced by this dampening, by means of a detrending procedure. This is explained in the Materials an Methods, and now full details are given in the new Supplementary Materials.

      (c) Figure 1E, K Is this data pooled across 2-3 experiments, as discussed in lines 500-01 under 'Statistical Analysis'? Also, what test is being performed to check for differences between proportions here, seeing as there are no error bars to denote error around a mean value and no other viable tests mentioned in Statistical Analysis?

      We are sorry for this omission. For the comparison of proportions we used the 'N-1' Chisquared test. We have added a sentence detailing this at the end of the Statistical analysis section.

      (d) Figure 1 F, L Can the total number of weakly and strongly rhythmic values be indicated in the scatter plot?

      Corrected.

      (e) Figure 1F, L (legend) Is the Chi-squared test being performed on the proportion values of Figure 1(E, K) or for Figure 1(F, L)?"

      The chi-squared test mentioned was used for Fig1 F-L. As explained above, for the comparison of proportions we used 'N-1' Chi-squared test. This has now been added to the legend of the figure

      (f) Page 8 Figure 2B Seeing as individual flies with a LS periodogram power < 0.2 are considered weakly rhythmic in Figure 1 F, L can Clk856 > perRNAi flies on average also be considered weakly rhythmic, as the peak in the periodogram is above 0.3?

      We prefer to use the weakly rhythmic class only for individual flies. Nevertheless, we agree that this periodogram shows that the genotype analyzed is not completely arrhythmic, and that this might be due to some remaining individual rhythmicity. As mentioned above, we have rewritten the last paragraph of the first subsection of section Results in order to discuss this.

      (g) Figure 2D Can the authors comment on why there is a shorter period rhythm when PDF neurons have a dysfunctional clock, whereas previous evidence (Howlader et al., 2004) suggested that these neurons play no role in egg-laying rhythm? They should also refer to McCabe and Birley, 1998 to see if their results (where they observed a shorter period of ~19h with groups of per0 flies), might be of interest in their interpretations.

      We have added a line commenting this in the corresponding subsection ("LNv and DN1 neurons are not necessary for egg-laying rhythmicity") of the Results, as well as a discussion of this in the third paragraph of the Discussion. In a nutshell, even though Howlader et al did not find a shortening when PDF neurons are ablated, they did find it in pdf01 flies.

      (h) Figure 2 F, H As the authors mention in their Discussion on Page 16, lines 340-45, the manipulation of DN1p neurons might abolish the circadian rhythm in oogenesis as reported by Zhang et al, which is why they looked at this circuit driven by Clk4.1 neurons and comment that "The persistence of the rhythm of oviposition implies that it is not based on the availability of eggs but is instead an intrinsic property of the motor program". However, no change in fecundity is reported for either kir2.1 or perRNAi-based manipulations of these neurons, to help the reader understand if egg availability (at the level of egg formation) is playing any role in the downstream (and seemingly independent) act of egg laying. The authors should report if they see any change in total fecundity for either set of flies w.r.t their respective controls. Also, is the reduction in power seen with electrical silencing vs perRNAi expression of any relevance? Does the percentage of rhythmic flies change between these two manipulations?

      In the line mentioned by the reviewer what we meant is that our results show that the rhythm of oviposition does not seem to be based in the rhythmic production of oocytes, which is not necessarily connected with the total number of eggs produced. We have modified the corresponding line in the paper, in order to avoid this misunderstanding. Regarding the "reduction in power" mentioned, it must be stressed that, in general, the height of the peak is correlated with the fraction of rhythmic individuals. The problem is that this fraction is a much more noisy output, and that is the reason why we have chosen to work with periodograms of averages.

      (i) Figure 2 E and G, a loss of rhythmicity could also be due to a decrease in fecundity in the experimental lines. Since the number of eggs laid for each genotype is already known, can the authors show statistically relevant comparisons between the experimental lines and their respective controls? In this vein, can the averaged time series profiles also be provided for all the genotypes tested (as seen previously in Figure 1 A, C, G, I), perhaps in the supplementary?

      We did not focus on fecundity in the present work. However, our observations do not seem to show any definite relationship with rhythmicity. We plan to address the issue of fecundity more systematically in a future work. The averaged time series profiles have now been added to the figure.

      (j) Scatter plots showing the average period and SEM as seen in Figure 1 (F, L) would help in understanding if these manipulations have any effect on variation in the period of the egg-laying rhythm across flies. Particularly for pdf GAL4 > perRNAi flies which have a net shorter period, (but this might vary across the 34 flies tested).

      We have added a Supplementary Figure (2S1) that shows that the shortening of oviposition period can be also observed at the individual level. We have also added a line commenting this in the corresponding subsection ("LNv and DN1 neurons are not necessary for egg-laying rhythmicity") of the Results, as well as a discussion of this in the third paragraph of the Discussion.

      (k) Page 11 Figure 3B Does the presence of two peaks in the LS periodogram at a power > 0.2 indicate the presence of weakly rhythmic flies with both a short(20h) and a long(~27h) period component or either one? The short-period peak is nearly at p < 0.05 level of significance. So then, do most of the flies in MB122B GAL4 > perRNAi line show a weakly rhythmic shorter period?

      (l) Figure 3D A similar peak is observed again at 20h (LS power > 0.2 and nearly at p < 0.05 significance level again) and a different longer one at (~30h) though this one is almost near 0.2 on the power scale. Given the consistency of this feature in both LNd manipulations, the authors should comment on whether this is driven by variation in periods detected or the presence of complex rhythms (splitting or change in period) in the oviposition time series for these lines.

      (m) Figure 3 General scatter plots showing average period {plus minus} SEM could help explain the bimodality seen in the periodograms. Additionally indicating just how many flies are weakly rhythmic vs. strongly rhythmic can also help to illustrate how important the CRY+ LnDs are to the oviposition rhythm's stability.

      For these three comments (k, l and m), we note that the issue of bimodality has been addressed above, in our response to Weakness 9.

      (o) Figure 4B Same as comments under Figure 1, what is the statistical test done to compare the proportions for these three genotypes?

      As mentioned above, for the comparison of proportions we used the 'N-1' Chi-squared test. We have added a sentence detailing this at the end of the Statistical analysis section.

      (p) Figure 4C Are all flies significantly rhythmic? The authors should also provide an averaged LS periodogram measure for each genotype, to help illustrate the difference in power between activity-rest and egg-laying rhythms.

      Yes, the points represent periods of (significantly) rhythmic flies. This has been added to the caption, to avoid misunderstandings. The differences that arise when assessing rhythmicity in activity records vs. egg-laying records is addressed at length in the Supplementary Material (see e.g. Fig S1).

      (q) Page 15 Figure 5 - general As the authors discuss the possible contribution of DN1ps to evening activity and control over oogenesis rhythm, investigating the connections of the few that are characterized in the connectome (or lack thereof) with the Oviposition neurons, can help illustrate the distinct role they play in the female Drosophila's reproductive rhythm.

      This information was in the text and the Supplementary Tables. Lines 273-275 of the old manuscript read: "The full results are displayed in Supplementary Tables 2 and Table 3, but in short, we found that whereas there are no connections between LNv or DN1 neurons and oviposition neurons..."

      (r) Minor: The dark shading of the circles depicting some of the clusters makes it difficult to read. Consider changing the colors or moving the names outside the circles.

      Figure corrected.

      (s) Line 38: The estimated number of clock neurons has been revised recently (https://www.biorxiv.org/content/10.1101/2023.09.11.557222v2.article-info).

      Thank you for the reference. We have corrected the number of clock neurons in the Introduction of the new manuscript.

    1. eLife Assessment

      This study presents a valuable finding on the mutational order for common alterations in colorectal cancer. The evidence of in vitro growth assays comparing mutations is solid, although inclusion of biological replicates for the transcriptional assessments and in vivo experiments would have strengthened the study. The work will be of interest to scientists working in the field of colon cancer.

    2. Reviewer #1 (Public review):

      Summary:

      In this study, Li et al. used genetically engineered murine intestinal organoids to investigate how the temporal order of oncogenic mutations influences cell state and tumourigenicity of colorectal epithelial cells. By sequentially introducing Apc and Trp53 loss-of-function mutations in alternate orders within a Kras^G12D background, the authors generated isogenic organoid lines for both in vitro and in vivo characterisation. Bulk RNA-seq reveals expected transcriptional changes with relatively modest differences between the two triple-mutant configurations (KAT vs KTA). The key finding emerges from transplantation assays: while KAT and KTA organoids show equivalent tumourigenic potential in immunodeficient mice, only KAT organoids form tumours in immunocompetent hosts (5/10 vs 0/10), suggesting that mutation order shapes susceptibility to immune-mediated clearance. The experiments are well-executed, and the conclusions are generally supported by the data.

      Strengths:

      The experimental system is well-designed for the question. By combining a Kras^G12D transgenic background with sequential CRISPR-mediated knockout of Apc and Trp53 in alternate orders, the authors generated truly isogenic organoid lines that differ only in mutational sequence. This is technically non-trivial and provides a clean platform for dissecting order effects, a question otherwise difficult to address experimentally.

      The authors performed comprehensive baseline characterisation of these organoids, including morphological and histological assessment, quantification of organoid-forming efficiency and proliferation, and bulk RNA-seq profiling. While these analyses revealed no major differences between KAT and KTA organoids, and the observed enhancement of epithelial stemness upon Apc loss and proliferative advantage conferred by Trp53 loss are largely expected, the systematic nature of this characterisation establishes a useful methodological template for future organoid-based studies.

      The authors further investigated the functional impact of mutational order using subcutaneous transplantation assays. By comparing tumour formation in immunodeficient versus immunocompetent hosts, the authors uncover a genuinely unexpected finding: KAT and KTA organoids behave equivalently in the absence of adaptive immunity, but diverge dramatically when immune pressure is applied (KAT: 5/10; KTA: 0/10). This observation is arguably the most compelling aspect of the study and opens an interesting line of inquiry.

      Weaknesses:

      The authors acknowledge that initiating with Kras^G12D does not reflect the typical human sporadic CRC trajectory, where APC loss is usually the first event. While this design choice was pragmatic, it means the observed order effects are contextualised within an artificial starting point. It remains unclear whether the Apc/Trp53 order would matter in a Kras-wild-type background, or whether the Kras-driven cellular state is a prerequisite for these phenotypes to emerge.

      Subcutaneous implantation provides a tractable readout of tumourigenicity, but the cutaneous immune microenvironment differs substantially from that of the intestinal mucosa. Given that the central claim concerns immune-mediated selection, orthotopic transplantation would more directly test whether the observed order effects hold in a physiologically relevant context.

      The ssGSEA comparison involves only 14 ATK tumours, and the key comparisons (Figure 6E) yield borderline significance (p=0.052). More fundamentally, since mutation order cannot be inferred from the clinical samples, the authors are correlating organoid-derived IFN signatures with tumour immunophenotypes without direct evidence that these patients' tumours followed a KAT-like trajectory. The reasoning becomes circular: KAT organoids define the signature used to identify KAT-like clinical tumours.

      Furthermore, the most striking finding of the study, that KTA organoids fail to form tumours in immunocompetent hosts while KAT organoids can, lacks a mechanistic follow-up. The transcriptomic differences between KAT and KTA are modest when cultured as monocultures, yet their in vivo fates diverge dramatically. The authors do not address why these subtle intrinsic differences translate into such divergent immune susceptibility, nor do they characterise the immune response adequately (beyond limited CD4/CD8 IHC at tumour peripheries).

    3. Reviewer #2 (Public review):

      Summary:

      This study addresses an important and timely question in colorectal cancer biology by systematically examining the effects of the common driver mutations APC, KRAS G12D, and TP53 in murine colorectal organoids, with particular emphasis on how the order of APC and TP53 acquisition influences tumor phenotype. These mutations are well known to be frequent, truncal, and often co-occurring in colorectal cancer. While it is increasingly appreciated that mutational order can shape tumor behavior, studies directly comparing the phenotypic consequences of alternative APC-TP53 mutation orders remain rare. This work, therefore, addresses a relevant and timely question.

      Strengths:

      A major strength of the study is its focus on previously unexplored biology, combined with the generation of multiple isogenic murine organoid models with controlled mutational sequences. The authors employ careful and robust quality control of the CRISPR-mediated alterations, and the inclusion of both in vitro and in vivo experiments strengthens the relevance of the work.

      Weaknesses:

      There are, however, several limitations that should be considered when interpreting the findings. First, KRAS G12D activation is used as the initiating alteration, whereas APC loss is generally believed to be the initiating event in most human colorectal cancers. Second, the analysis is restricted to comparing only two mutation orders (KAT versus KTA), which limits the breadth of conclusions that can be drawn about mutation ordering more generally. Finally, key RNA-sequencing and in vivo experiments rely on a single isogenic line, which substantially constrains interpretability.

      The aim of the study was to systematically investigate how mutation accumulation and order influence colorectal cancer initiation. While the data suggest that the relative timing of APC and TP53 loss may be particularly important for tumor initiation, the absence of biological replication makes it difficult to draw robust conclusions. Engraftment efficiency and tumor behavior can be influenced by many factors for a single clone, including additional passenger mutations acquired during culturing, as well as epigenetic differences that are independent of the engineered mutations.

    4. Author response:

      Public Reviews: 

      Reviewer #1 (Public review): 

      Summary: 

      In this study, Li et al. used genetically engineered murine intestinal organoids to investigate how the temporal order of oncogenic mutations influences cell state and tumourigenicity of colorectal epithelial cells. By sequentially introducing Apc and Trp53 loss-of-function mutations in alternate orders within a Kras^G12D background, the authors generated isogenic organoid lines for both in vitro and in vivo characterisation. Bulk RNA-seq reveals expected transcriptional changes with relatively modest differences between the two triple-mutant configurations (KAT vs KTA). The key finding emerges from transplantation assays: while KAT and KTA organoids show equivalent tumourigenic potential in immunodeficient mice, only KAT organoids form tumours in immunocompetent hosts (5/10 vs 0/10), suggesting that mutation order shapes susceptibility to immune-mediated clearance. The experiments are well-executed, and the conclusions are generally supported by the data. 

      Strengths: 

      The experimental system is well-designed for the question. By combining a Kras^G12D transgenic background with sequential CRISPR-mediated knockout of Apc and Trp53 in alternate orders, the authors generated truly isogenic organoid lines that differ only in mutational sequence. This is technically non-trivial and provides a clean platform for dissecting order effects, a question otherwise difficult to address experimentally. 

      The authors performed comprehensive baseline characterisation of these organoids, including morphological and histological assessment, quantification of organoid-forming efficiency and proliferation, and bulk RNA-seq profiling. While these analyses revealed no major differences between KAT and KTA organoids, and the observed enhancement of epithelial stemness upon Apc loss and proliferative advantage conferred by Trp53 loss are largely expected, the systematic nature of this characterisation establishes a useful methodological template for future organoid-based studies. 

      The authors further investigated the functional impact of mutational order using subcutaneous transplantation assays. By comparing tumour formation in immunodeficient versus immunocompetent hosts, the authors uncover a genuinely unexpected finding: KAT and KTA organoids behave equivalently in the absence of adaptive immunity, but diverge dramatically when immune pressure is applied (KAT: 5/10; KTA: 0/10). This observation is arguably the most compelling aspect of the study and opens an interesting line of inquiry. 

      We greatly appreciate your positive comments on our study.

      Weaknesses: 

      The authors acknowledge that initiating with Kras^G12D does not reflect the typical human sporadic CRC trajectory, where APC loss is usually the first event. While this design choice was pragmatic, it means the observed order effects are contextualised within an artificial starting point. It remains unclear whether the Apc/Trp53 order would matter in a Kras-wild-type background, or whether the Kras-driven cellular state is a prerequisite for these phenotypes to emerge. 

      We agree with the reviewer that initiating tumorigenesis with Kras<sup>G12D</sup> does not fully recapitulate the most common trajectory of sporadic human CRC, where APC loss typically occurs first. We had noted this point in the original Discussion and will further clarify it more explicitly in the Introduction part of the revised manuscript.

      Our experimental design was intended to establish a controlled and genetically tractable system to interrogate the principle of mutation order effects. In this context, Kras<sup>G12D</sup> activation provides a stable oncogenic baseline that facilitates sequential genome engineering and comparison of isogenic lines.

      Although APC loss is frequently the initiation event, a recent study has suggested that Kras<sup>G12D</sup> priming can reshape the selective landscape for subsequent driver events, including Apc alterations (PMID: 41339549). Consistent with this notion, our data indicate that Kras<sup>G12D</sup> activation induces a permissive oncogenic cellular state that may influence the phenotypic consequences of later mutations. We therefore speculate that the Kras<sup>G12D</sup>-primed context may contribute to the observed order-dependent effects.

      We agree that testing Apc/Trp53 order in a Kras-wild-type background would be an important future direction, and we will point this out explicitly in the revised Discussion.

      Subcutaneous implantation provides a tractable readout of tumourigenicity, but the cutaneous immune microenvironment differs substantially from that of the intestinal mucosa. Given that the central claim concerns immune-mediated selection, orthotopic transplantation would more directly test whether the observed order effects hold in a physiologically relevant context. 

      In the present study, we employed subcutaneous transplantation, which is a widely used platform to assess tumorigenic potential under controlled immune conditions. This approach offers high reproducibility, straightforward tumor monitoring, and has been broadly applied in organoid-based cancer studies in both immunodeficient (PMID: 23273993, 23776211, 32209571, 33055221) and immunocompetent (PMID: 32209571, 33055221, 41672595) settings.

      Importantly, our primary goal was to determine whether mutation order influences susceptibility to immune-mediated clearance, rather than to model the full complexity of the intestinal niche. The clear divergence between KAT and KTA specifically in immunocompetent hosts supports the existence of intrinsic mutation order-dependent immune vulnerability.

      Nevertheless, we fully agree with the reviewer that orthotopic transplantation would provide a more physiologically relevant immune microenvironment and represents also an important direction for future investigation. We will explicitly discuss this limitation and highlight orthotopic validation as an important future direction in the revised Discussion.

      The ssGSEA comparison involves only 14 ATK tumours, and the key comparisons (Figure 6E) yield borderline significance (p=0.052). More fundamentally, since mutation order cannot be inferred from the clinical samples, the authors are correlating organoid-derived IFN signatures with tumour immunophenotypes without direct evidence that these patients' tumours followed a KAT-like trajectory. The reasoning becomes circular: KAT organoids define the signature used to identify KAT-like clinical tumours. 

      We thank the reviewer for raising this important point. We would like to clarify that our intention was not to infer the actual mutation order in clinical samples, which indeed cannot be reliably reconstructed from bulk tumor RNA-seq data.

      Instead, our goal was to determine whether the transcriptional programs distinguishing KAT and KTA organoids could be observed in human CRC cohorts. In this context, the organoid-derived IFN-related signature was used as a molecular reference to assess potential clinical relevance, rather than to classify tumors by evolutionary trajectory.

      We agree that the statistical significance in Figure 6E is modest (p = 0.052), and we would like to revise the text to present this analysis more cautiously as a suggestive trend rather than definitive evidence. We will also clarify this limitation explicitly in the revised manuscript to avoid overinterpretation.

      Furthermore, the most striking finding of the study, that KTA organoids fail to form tumours in immunocompetent hosts while KAT organoids can, lacks a mechanistic follow-up. The transcriptomic differences between KAT and KTA are modest when cultured as monocultures, yet their in vivo fates diverge dramatically. The authors do not address why these subtle intrinsic differences translate into such divergent immune susceptibility, nor do they characterise the immune response adequately (beyond limited CD4/CD8 IHC at tumour peripheries). 

      We thank the reviewer for this important point. We agree that the mechanistic basis underlying the differential immune susceptibility between KAT and KTA remains incompletely resolved.

      A practical limitation of the current study is that KTA grafts failed to establish tumors in immunocompetent hosts, which precluded downstream histological and immune profiling of established lesions. As a result, our in vivo immune characterization of KTA grafts is nearly impossible.

      Nevertheless, our transcriptomic analyses indicate that KAT and KTA organoids differ in interferon-response and immune-related programs prior to transplantation, and those differentially expressed genes were consistently preserved in tumor cells derived from immunodeficient hosts. These results suggest the presence of intrinsic tumor-cell-autonomous differences may influence immune recognition and clearance.

      We will expand the Discussion to outline several non-mutually exclusive mechanisms that could account for this phenotype, including altered interferon responsiveness, differential antigen presentation capacity, and changes in tumor cell-intrinsic immune visibility programs. These hypotheses are consistent with the transcriptional differences observed prior to transplantation and provide a framework for future mechanistic investigation. We agree that deeper immune profiling (e.g., immune infiltrate composition, antigen presentation status, and functional immune assays) will be important to fully elucidate the mechanism and represents a key direction for future work.

      Reviewer #2 (Public review): 

      Summary: 

      This study addresses an important and timely question in colorectal cancer biology by systematically examining the effects of the common driver mutations APC, KRAS G12D, and TP53 in murine colorectal organoids, with particular emphasis on how the order of APC and TP53 acquisition influences tumor phenotype. These mutations are well known to be frequent, truncal, and often co-occurring in colorectal cancer. While it is increasingly appreciated that mutational order can shape tumor behavior, studies directly comparing the phenotypic consequences of alternative APC-TP53 mutation orders remain rare. This work, therefore, addresses a relevant and timely question. 

      Strengths: 

      A major strength of the study is its focus on previously unexplored biology, combined with the generation of multiple isogenic murine organoid models with controlled mutational sequences. The authors employ careful and robust quality control of the CRISPR-mediated alterations, and the inclusion of both in vitro and in vivo experiments strengthens the relevance of the work.

      We greatly appreciate your positive comments on our study.

      Weaknesses: 

      There are, however, several limitations that should be considered when interpreting the findings. First, KRAS G12D activation is used as the initiating alteration, whereas APC loss is generally believed to be the initiating event in most human colorectal cancers.

      We sincerely thank the reviewer for their insightful comments regarding the initiation of tumorigenesis with a Kras mutation rather than the more canonical Apc loss, which was also raised by the reviewer #1. We fully agree that the Apc-first represents the most prevalent sequence in human colorectal cancer (CRC), We will more clearly explain the rationale for our experimental design in the revised Introduction part as outlined in our response to reviewer #1.

      Second, the analysis is restricted to comparing only two mutation orders (KAT versus KTA), which limits the breadth of conclusions that can be drawn about mutation ordering more generally.

      We thank the reviewer for pointing this limitation out. However, as a proof-of-concept, study of Apc and Trp53 loss, two major oncogenic events in CRC, serves as a biologically meaningful starting point for dissecting order-dependent effects. Although it is of great significance to compare all six possible mutation orders of these three driver genes, generating and thoroughly characterizing all genotypes represents a substantial undertaking beyond the scope of this initial study.

      Finally, key RNA-sequencing and in vivo experiments rely on a single isogenic line, which substantially constrains interpretability. 

      The aim of the study was to systematically investigate how mutation accumulation and order influence colorectal cancer initiation. While the data suggest that the relative timing of APC and TP53 loss may be particularly important for tumor initiation, the absence of biological replication makes it difficult to draw robust conclusions. Engraftment efficiency and tumor behavior can be influenced by many factors for a single clone, including additional passenger mutations acquired during culturing, as well as epigenetic differences that are independent of the engineered mutations.

      We thank the reviewer for raising his/her concern. We apologize that we have not made a clear presentation of our data source. Indeed, for all major in vitro and in vivo assays of double and triple mutants (KA/KT/KAT/KTA), we analyzed at least two independently derived clones per genotype. These independent clones harbor distinct mutations in target genes and were treated as biological replicates throughout the study.

      To improve clarity and transparency, we will revise the relevant figures and figure legends to explicitly indicate the clonal origin of each data point.

    1. eLife Assessment

      This study presents an important investigation of how people approach and avoid uncertainty, with a particular focus on the effects of overall uncertainty. They find that individuals approach uncertainty to a point, but when uncertainty is particularly high, they avoid it. The results are interpreted under a cognitive cost-resource rational framework. The methods are convincing, using appropriate and current methodologies.

    2. Reviewer #1 (Public review):

      This manuscript reports on the behavior of participants playing a game to measure exploration. Specifically, participants completed a task with blocks of exploratory choices (choosing between two 'tables', and within each table, two 'card decks', each of which had a specific probability of showing cards with one color versus another) and test choices, where participants were asked to choose which of the two decks per table had a higher likelihood of one color. Blocks differed on how long (how many trials) the exploration phase lasted. Participants' choices were fit to increasingly complex models of next-trial exploration. Participants' choices were best fit by an intermediate model where the difference in uncertainty between tables influenced the choice. Next, the authors investigated factors affecting whether participants sought out or avoided uncertainty, their choice reaction times, and the relationship of these measures with performance during the test phase of each block. Participants were uncertainty-seeking (exploratory) under most levels of overall uncertainty but became less uncertainty-seeking at high levels of total uncertainty. Participants with a stronger tendency to approach uncertainty at lower levels of total uncertainty were more accurate in the test phase, while the tendency to avoid uncertainty when total uncertainty was high was also weakly positively related to test accuracy. In terms of reaction times, participants whose reaction times were more related to the level of uncertainty, and who deliberated longer, performed better. The individual tendency to repeat choices was related to avoidance of uncertainty under high total uncertainty and better test performance. Lastly, choices made after a longer lag were less affected by these measures.

    3. Author response:

      The following is the authors’ response to the original reviews

      We would like to sincerely thank the editor and reviewers for their thoughtful and constructive feedback on our manuscript. We are grateful not only for the close reading and insightful suggestions, but also for the open and generous way in which the reviewers engaged with our work. In revising the manuscript, we have clarified how our contribution is situated within the existing literature, conducted additional analyses to examine individual differences in exploration strategies, expanded and refined our description of the DDM analyses, and added correlations between strategies and other behavioral measures. We have also clarified methodological points, such as the estimation of thresholds, and provided new supplementary figures and analyses where appropriate. In several places, we have modified and qualified our interpretations in line with the reviewers’ comments. We believe these changes have significantly strengthened the manuscript, and we are grateful for the scientific dialogue with the reviewers.

      Review 1 (Public review):

      This manuscript reports on the behavior of participants playing a game to measure exploration. Specifically, participants completed a task with blocks of exploratory choices (choosing between two 'tables', and within each table, two 'card decks', each of which had a specific probability of showing cards with one color versus another) and test choices, where participants were asked to choose which of the two decks per table had a higher likelihood of one color. Blocks differed on how long (how many trials) the exploration phase lasted. Participants' choices were fit to increasingly complex models of next-trial exploration. Participants' choices were best fit by an intermediate model where the difference in uncertainty between tables influenced the choice. Next, the authors investigated factors affecting whether participants sought out or avoided uncertainty, their choice reaction times, and the relationship of these measures with performance during the test phase of each block. Participants were uncertainty-seeking (exploratory) under most levels of overall uncertainty but became less uncertainty-seeking at high levels of total uncertainty. Participants with a stronger tendency to approach uncertainty at lower levels of total uncertainty were more accurate in the test phase, while the tendency to avoid uncertainty when total uncertainty was high was also weakly positively related to test accuracy. In terms of reaction times, participants whose reaction times were more related to the level of uncertainty, and who deliberated longer, performed better. The individual tendency to repeat choices was related to avoidance of uncertainty under high total uncertainty and better test performance. Lastly, choices made after a longer lag were less affected by these measures.

      The authors note that their paradigm, which does not provide immediate rewarding feedback, is novel. However, the resulting behavior appears similar to other exploratory learning tasks, so it's unclear what this task design adds - besides perhaps showing that exploratory behavior is similar across types of reward environments. Several papers have shown that cognitive constraints modulate exploration (PMIDs: 30667262, 24664860, 35917612, 35260717); although this paper provides novel insights, it does not situate its findings in the context of this prior literature. As a result, what it adds to the literature is difficult to discern.

      We are grateful for your thoughtful reading of our paper and for pointing us to these relevant references. We appreciate the need to clarify how our work is situated within the existing literature. In brief, the novelty of our paper lies in measuring exploration in contexts where it is not in direct competition with the need to exploit knowledge for reward. This approach enables us to include orders of magnitude more exploration trials. With this increased power, we were able— for the first time— to distinguish between competing algorithms for addressing uncertainty, and we identified a novel tendency to avoid uncertainty when overall uncertainty is high. We now state this more clearly in the discussion section and cite the suggested papers.

      “While the literature on exploration is expansive, the paradigm presented here extends it in important ways. Researchers of reinforcement learning have previously examined exploration in the context of reward-seeking decisions. Using such paradigms as the bandit task Schulz and Gershman (2019), it was demonstrated that humans don't always choose the option they believe will yield the most reward, but also make random and directed choices with the aim of exploring other uncertain options (Schulz and Gershman, 2019; Wilson et al., 2014). Recently, studies using the bandit task have lent empirical support to the notion that exploration is difficult, as participants explore less under time pressure or cognitive load (Brown et al., 2022; Otto et al., 2014; Cogliati Dezza et al., 2019; Wu et al., 2022). Crucially, this literature has focused on cases where reward can be gained on each trial (Brown et al., 2022; Cohen et al., 2007; Daw et al., 2006; Schulz and Gershman, 2019; Song et al., 2019; Tversky and Edwards, 1966; Wilson et al., 2014; Wu et al., 2022). In such tasks, the motivation to exploit current knowledge predominates exploration, rendering it rare and difficult to measure (Findling et al., 2019). In contrast, our task was designed to remove the impetus to immediately exploit current knowledge , and as a result we were able to observe many exploratory choices. With this increased experimental power, we were able to compare different algorithms approximating the goal of approaching uncertainty, and describe how and when humans avoid uncertainty instead of approaching it.”

      Reviewer #1 (Recommendations For The Authors):

      Are all participants best fit by the delta uncertainty model? Since other parts of the paper focus on individual differences, it would be useful to examine if people differ in the computational complexity of their exploration strategies and if this difference relates to other behavior.

      We thank you for this helpful suggestion, which prompted us to conduct additional analyses. To address your question, we summarized point-wise predictive accuracy for each participant and compared it across the three models. The results are presented in the new Supplements 2 and 3 to Figure 6.

      These analyses show that, for the vast majority of participants, uncertainty was favored over exposure as a choice strategy, and for a sizable majority, it was also favored over EIG. As detailed in Figure 6 and its supplements, 125 participants were best described by uncertainty relative to EIG, 58 by EIG, and 11 showed inconclusive results. Similarly, 96 participants were better fit by uncertainty than exposure, while an additional 72 had negative exposure coefficients (consistent with uncertainty-based choice). Exposure was supported for 26 participants.

      We also examined how these strategies relate to other behavioral measures. Exposure was not strongly linked to test performance. EIG, by contrast, showed a positive association with test performance, perhaps because it is more closely correlated with uncertainty. Importantly, however, across posterior predictive checks in the main text and supplements, approaching uncertainty continues to provide the best overall description of participants’ strategies.

      The authors construct a hierarchy of exploratory strategies. Perseveration/switching is also an explore/exploit strategy that would lie above random exploration in the authors' hierarchy.

      We chose not to place perseveration within the hierarchy, as from a normative perspective it is not, strictly speaking, an exploration strategy. At its extreme, perseveration would lead a participant to repeatedly sample only one option, leaving the others entirely unexplored. Switching is represented in the hierachy by the equating exposure strategy – they are very similar.

      For the analyses examining uncertainty seeking vs. aversion by total uncertainty, how was the cut point determined? Did this differ across people?

      Thank you for highlighting the need for greater clarity on this point. The threshold was indeed fitted to the data and varied significantly across participants (see Table 6 in Appendix 3). For each participant, the threshold marks the point at which behavior shifts from approaching to avoiding uncertainty. This threshold is a key factor underlying individual differences in the tendency to avoid uncertainty when overall uncertainty is high, as illustrated in the analyses of Figure 6 and related results. We now make this point clearer in the methods section:

      “To quantify how the influence of Δ-uncertainty on choice varied with overall uncertainty, we fit a multilevel piecewise logistic regression model. This model estimated a threshold in overall uncertainty, treated as a free parameter, and allowed the slope of Δ-uncertainty on choice to differ below and above this threshold. Below the threshold, a positive slope reflects a tendency to approach uncertainty; above the threshold, a negative interaction captures the tendency to avoid Δ-uncertainty with higher values of overall uncertainty.”

      More details on the DDM analyses are needed - it's not clear how the outputs of the DDM correspond to what is stated in the text in the results.

      We agree that the section detailing the DDM analyses could be clarified. We analyzed two key parameters of the DDM: the drift rate, which we interpret as reflecting the efficacy of deliberation over uncertainty, and the bound separation, which corresponds to the tendency to deliberate rather than respond quickly. Our results show that good learners exhibit both higher drift rates and higher bounds. When participants repeat a previous choice, both the drift rate and bounds are lower. We changed the way we report the results:

      “We found that RTs indeed varied in relation to the absolute value of Δ-uncertainty as expected b=0.69, 95\% PI=[0.58,0.78]. Crucially, a stronger dependence of RT on the absolute value of Δ-uncertainty predicted better performance at test (drift-rate and test performance association b=0.81, 95% PI=[0.58,1.07]). We further found that participants who tended to deliberate longer for the sake of accuracy also tended to perform better at test (bound height and test perfromance association b=1.46, 95% PI=[0.58,2.34]; Figure8c). In summary, participants who were better at deliberating about uncertainty during exploration, and who deliberated for longer, performed better at test. Thus, making good exploratory choices that lead to efficient learning involves prolonged deliberation.”

      We also provide a detailed explanation of this correspondence in the Methods section:

      “The DDM explains RTs as the culmination of three interpretable terms. The first is the efficacy of a participant’s thought process in furnishing relevant evidence for the decision - in our case the efficacy of choosing according to Δ-uncertainty (the drift rate in DDM parlance). The second term governs the participant’s speed-accuracy tradeoff by determining how much evidence they require to commit to a decision. This can also be thought of as how long a participant is willing to deliberate when a decision is difficult (bound height). Finally, the portion of the RT not linked to the deliberation process is captured by a third term (non-decision time).”

      The authors note that "the three choice strategies prescribe different table choices on most trials" but (from what I can see) only provide a representative participant's plot in Figure 2. What was the overall correlation of predicted choices from the three models?

      Thank you for pointing out this oversight. The correlations are now shown in the supplement to Figure 2. In brief, correlations between exposure and the other two strategies are low, while the correlation between EIG and uncertainty is moderate. These dependencies motivated our decision to fit a separate logistic regression model for each strategy and to compare strategies using formal model comparison and posterior predictive checks, rather than including them all in a single regression model.

      It appears that the models are all constructed to predict table choices and not card deck choices. Can the authors clarify this? If so, what role do the card deck choices have?

      Indeed, the manuscript focuses on table choices, as these are the choices of primary interest from an exploration perspective. It is most straightforward to define the three exploration strategies with respect to table choices, whereas for deck choices it is not clear how to define EIG in respect to the perforamnce at test. The hierarchical structure of the task was originally chosen to increase complexity, with the goal of creating a rich task that engages cognitive resources. We have not formally tested this assumption, and do not expect that the patterns we observe should be absent in a flat version of the task.

      Reviewer 2 (Public review):

      Summary:

      This paper focuses on an interesting question that has puzzled psychologists for decades, that is, why do people demonstrate a mix of uncertainty approach and avoidance behavior, given the fact that reducing uncertainty could always gain information and seems beneficial? This paper designed a novel task to demonstrate behavioral signatures of uncertainty approaching and avoidance during the exploration phase within the same task at both a within-subject and betweensubject level. On the algorithmic level, this paper compared four different implementations of uncertainty-guided exploration and found that the model sensitive to relative uncertainty provides the best fit for human behavior compared to its counterparts using expected information gain or past exposure. This paper then links people's uncertainty attitude with accuracy and finds that uncertainty avoidance during exploration does not impair task performance, implying that uncertainty avoidance may be the output of a resource-rational decision-making process. To examine this account, this paper uses reaction time as an independent proxy of costly deliberation and shows that people deliberate shorter when engaging in repetitive choice, which presumably saves cognitive resources. Finally, the paper shows that people's tendency to engage in repetitive choice correlates with their tendency to avoid uncertainty, which supports the argument that avoiding uncertainty could be a strategy developed under the constraint of limited cognitive resources.

      Strengths:

      One of the highlights of this paper, as mentioned in the previous paragraph, is that the authors can establish the existence of the uncertainty approach and avoidance behavior within the same task whereas previous work usually focuses on one of them. This dissociation allows the authors to examine what situational factor is related to the emergence of the act of avoiding uncertainty, and extract parameters describing participants' attitude towards uncertainty during baseline as well as during situations where uncertainty avoidance is more common. Besides documenting the existence of uncertainty avoidance behavior, this paper also tried to explain this behavior by proposing under the resource rational framework and has carefully quantified different aspects (e.g., accuracy; choice speed) of participants' behavior as well as examined their relationships. Though more experiments are needed to fully understand human uncertainty avoidance behavior, this paper has provided both empirical and theoretical contributions toward a mechanistic understanding of how people balance approaching and avoiding uncertainty.

      Weaknesses:

      I have a couple of concerns related to this paper. First, there seems to exist an anticorrelation between total uncertainty and absolute relative uncertainty (Figure 5 panel C, \delta uncertainty is restricted to a small range when total uncertainty is high). It seems to be a natural product of the exploration process since the high total uncertainty phase is usually the period where the participant knows little about either option, leading to a less distinguishable relative uncertainty. However, it remains unknown whether the documented uncertainty avoidance still applies when extrapolating to larger absolute relative uncertainty.

      We sincerely thank you for your close reading of our manuscript and for highlighting its strengths. In the paradigm we study, overall and relative uncertainty are not anticorrelated. While the two are related—as in any finite-information exploration task, where the value of overall uncertainty constrains the possible range of relative uncertainty—they are not correlated and can therefore be used as predictors in a single regression model. We agree that strategies could differ substantially in a (near) infinite-information setting, such as when people seek semantic knowledge. The advantage of a finite-information task is its tractability, which enables the computational analyses we conducted. That said, the inherently greater intractability of an infinite-information task would likely alter human strategies, as it poses challenges both to participants and to researchers.

      It would be great if the experiment allows for a manipulation of uncertainty in the middle of the experiment (e.g., introducing a new deck/informing that one deck has been updated)

      We agree, and look forward to probing this question in the future. We’ve added the point to our discussion section:

      “Our theoretical analysis and experiments leave several open questions. One concerns the relationship between overall uncertainty and time on task: in our paradigm, overall uncertainty was correlated with the number of cards observed. Although our findings remain robust when trial number is included as a covariate in the regression models, future work could more directly disentangle these factors by orthogonalizing overall uncertainty and elapsed time. This might be achieved, for instance, by manipulating overall uncertainty within a game—such as by introducing new tables or altering outcome probabilities mid-round.”

      Relatedly, the current 'threshold' of uncertainty avoidance behavior, if I understand correctly, is found by empirically fitting participants' data. This brings the question: can we predict when people will demonstrate uncertainty avoidance behavior before collecting any data? Or, is it possible that by measuring some metrics related to cognitive cost sensitivity, we could predict the proportion of choices that participants will show uncertainty-avoidant behavior?

      Thank you again for probing our thinking further. The threshold of uncertainty is indeed fitted on an individual basis using a hierarchical model. We believe there should be ways to predict it. In the current data, we find that it is correlated with the baseline tendency to approach uncertainty: in other words, participants who perform better show a slightly stronger tendency to avoid uncertainty when overall uncertainty is high. This underscores the complexity of identifying correlates of a coping strategy, as it is intricately linked to the difficulty being coped with. We speculate that working memory capacity may play an important role in this strategy, as well as the interplay between working memory–based learning and slower incremental learning mechanisms. Beyond speculation, however, we currently have no data to test these ideas.

      Finally, regarding the analysis of different behavior patterns in the game, it seems that the authors try to link repetitive behavior, uncertainty attitude, and accuracy together by testing the correlation between the two of them. I wonder whether other multivariate statistical methods e.g., mediation analysis, will be better suited for this purpose.

      This was a very insightful comment. We revisited the data and fitted test performance using a multiple regression model, predicting performance from the three exploration-phase strategies simultaneously: baseline tendency to approach uncertainty, tendency to avoid uncertainty when overall uncertainty is high, and tendency to repeat previous choices. When adjusting for the baseline tendency to approach, we find that the tendency to avoid uncertainty is indeed associated with a slight decrement in test performance. However, in our sample, the better learners—who are more effective at approaching uncertainty—also tend to avoid it when overall uncertainty is high. This nuance highlights the point discussed earlier. We find similar results when fitting the data with a mediation model, but we favour the multiple regression approach, since have no strong convictions about which exploration strategy causes another. We have detailed this analysis in the main text and have accordingly modified and qualified our interpretation of this finding:

      “In contrast, the relationship between the tendency to avoid uncertainty and test performance was more nuanced. In both samples, participants who were more inclined to approach uncertainty also tended to avoid it when overall uncertainty was high r=0.43, p=5.42 x 10<sup>-10</sup>. Accordingly, avoidance was positively correlated with test performance at the population level b=1.18, 95% PI=[0.80, 1.58] Figure 7b; see Methods for parameter estimation). However, once we adjusted for the tendency to approach, avoidance was reliably associated with worse test performance b=-0.83, 95% PI=[-1.28,-0.40].”

      Reviewer #2 (Recommendations For The Authors):

      Could the authors elaborate more on why the negative relationship between exposure and choice (Figure 4a) is a natural phenomenon under the relative uncertainty model?

      Indeed, we believe this is a natural phenomenon under the uncertainty model. When simulating an uncertainty-driven agent, the negative relationship arises naturally. We interpret this as the agent repeatedly pursuing tables that are more difficult to learn—those with smaller probability differences. The agent is drawn to these tables precisely because they are harder to master. By contrast, an EIG-driven agent would not repeatedly return to tables that are too difficult to learn. We have revised the Results section to make this point clearer:

      “The simulations demonstrate that the surprising negative correlation between choice and Δ-exposure is an epiphenomenon of uncertainty-driven exploration: agents repeatedly return to harder-to-learn tables, gaining more exposure to them precisely because they remain more uncertain about these tables.”

      It would be great if the authors could provide the correlation between different uncertainty estimates to help the readers have a better sense of how different these estimates are.

      We’ve added this information in the supplement to Figure 2. In brief, correlations between exposure and the other two strategies are low, while the correlation between EIG and uncertainty is moderate. These dependencies motivated our decision to fit a separate logistic regression model for each strategy and to compare strategies using formal model comparison and posterior predictive checks, rather than including them all in a single regression model.

    1. eLife Assessment

      This important study convincingly demonstrates how bacterial cells can modulate outer membrane-peptidoglycan tethering by expressing two different Lpp homologs with distinct cross-linking efficiencies, revealing that Salmonella typhimurium LppB forms disulfide-based homodimers (or heterotrimers with Lpp when present) and is covalently attached to peptidoglycan primarily via the L,D-transpeptidase LdtB at residue K58. The evidence supporting the authors' claims is solid, including the regulatory role of LppB dimerization for its abundance in E. coli and its ability to inhibit Lpp/A crosslinking to peptidoglycan, although additional analysis and quantification of muropeptides in wild-type E. coli overexpressing LppB would further strengthen the findings. Overall, the work will be of great interest to microbiologists studying cell envelope biogenesis.

    2. Reviewer #1 (Public review):

      Summary:

      Pierre Despas et al. studied the role of Salmonella typhimurium LppB in outer membrane tethering. Using E. coli {delta}lpp mutant the authors showed that Salmonella LppB is covalently attached to PG through K58 and that these crosslinks are formed by the L,D-transpeptidase LdtB, primarily. Additionally, authors demonstrate that LppB forms homodimers via a disulfide bond through C57, but when Lpp is present it can also form heterotrimers with it. Thus, suggesting a regulatory role in Lpp-PG crosslinking.

      Strengths:

      In my view, this is a nice piece of work that expands our understanding of the role of lpp homologs. The experiments were well-designed and executed, the manuscript is well-written and the figures are well-presented.

      Weaknesses:

      I have some suggestions to give a clearer message, because I think a few images don't reflect much of what the authors wrote.

      It'd be helpful for readers to see the phylogenetic tree of the rest of the organisms that harbor LppB homologs and Lpp.

      Increased expression of LppB under low pH is subtle. This result would benefit from quantifying the blots (Fig. S1) and performing statistical analysis.

      Similarly, the SDS-EDTA sensitivity result (Fig. S2) is not convincing; the image doesn't seem to show isolated colonies at low pH (Fig. S2B). Please measure CFU/mL and report endpoint growth graphs instead. Statistical analysis should also be presented.

      The reduction to PG crosslinking of the C57R mutant is unclear (Fig 4B lane 22). The authors state: "suggesting that additional features of the LppB C-terminal region underlie its reduced efficiency." Does this mean additional amino acids play a role? Did the authors try to substitute Cys with other amino acid residues like Ala or Ser and quantify protein levels to find a mutant with similar expression levels? Do these have less crosslinking too?

    3. Reviewer #2 (Public review):

      Summary:

      The manuscript by Pierre Despas and co-workers, reports the biochemical characterization of LppB a peculiar Lpp (Braun's lipoprotein) homolog found in Salmonella enterica. S. enterica encodes two Lpp homologs LppA and LppB: while LppA and Lpp function similarly, the role of LppB is less clear. LppB shares with Lpp the C-terminal Lys needed for covalent attachment to peptidoglycan (PG) but diverges in residues that precede the terminal Lys featuring a Cys residue at the penultimate position. By using E. coli as a surrogate model, the authors show that LppB can be covalently linked to PG via the terminal Lys residues and that the penultimate Cys residue can be used to form homodimer species when expressed alone and heterotrimeric complexes when co-expressed with Lpp. Interestingly, LppB expressed in E. coli seems to be stabilized at acidic pH a condition Salmonella encounters in macrophage phagosomes. Finally, based on decreased intensity of LppB-PG crosslinked bands as LppB expression increases the authors suggest that LppB is able to negatively modulate the outer membrane-peptidoglycan connectivity.

      Strengths:

      The manuscript is interesting, describes a novel strategy employed by bacteria to fine tuning outer membrane-PG attachment and provides new insights into how envelope remodeling processes can contribute to bacterial fitness and pathogenicity.

      Weaknesses:

      The analysis and quantification of muropeptides formed in E. coli strains overexpressing LppB would strengthen the main conclusion of the manuscript.

    4. Reviewer #3 (Public review):

      Summary:

      The manuscript is interesting, and it is clearly written. While the experiments are well executed, a general flaw is that the LppA/B analyses are done in the E. coli K12 host as surrogate for Salmonella enterica. For the mechanistic and molecular analyses of LppB a surrogate host is certainly adequate, yet it limits extrapolation of the physiological implications of LppB in the natural context.

      Strengths:

      The work convincingly demonstrates that LppB forms disulfide-based dimers and that it is crosslinked to PG via LdtB in E. coli. Moreover, dimerisation is required for LppB abundance in E. coli and LppB can inhibit crosslinking of Lpp/A to PG in E. coli.

      Weaknesses:

      Regarding the key conclusion of the work: while it is shown that LppB is oxidized in E. coli, whether envelope integrity (or OMV production) changes arise from switches in oxidation of the LppB cysteines remains to be shown, for E. coli let alone in the native host Salmonella. Does expression of LppB influence Lpp/A activity or OM tethering in E. coli? Since the inhibition of the Lpp/A linking to PG is not affected by the oxidation state of LppB, the abstract/title implies redox-control of envelope integrity which is a bit misleading and an overstatement. Both are features of LppB: i.e. it dimerizes through disulfide bond formation and it reduces PG binding of Lpp/A through trimerisation. However, no link between the two is shown.

    5. Author response:

      Public Reviews:

      Reviewer #1 (Public review):

      Summary:

      Pierre Despas et al. studied the role of Salmonella typhimurium LppB in outer membrane tethering. Using E. coli ∆lpp mutant the authors showed that Salmonella LppB is covalently attached to PG throug K58 and that these crosslinks are formed by the L,Dtranspeptidase LdtB, primarily. Additionally, authors demonstrate that LppB forms homodimers via a disulfide bond through C57, but when Lpp is present it can also form heterotrimers with it. Thus, suggesting a regulatory role in Lpp-PG crosslinking.

      Strengths:

      In my view, this is a nice piece of work that expands our understanding of the role of lpp homologs. The experiments were well-designed and executed, the manuscript is wellwritten and the figures are well-presented.

      Weaknesses:

      I have some suggestions to give a clearer message, because I think a few images don't reflect much of what the authors wrote.

      We thank Reviewer #1 for this important comment. We agree that several figures could more directly illustrate the points made in the text. In a revised version, we intend to revise the relevant figure panels and legends to better align the visual message with the conclusions, and we will adjust the corresponding text to explicitly state what each figure demonstrates and how the data support our interpretation. We anticipate that these changes will improve clarity and strengthen the alignment between figures and text.

      It'd be helpful for readers to see the phylogenetic tree of the rest of the organisms that harbor LppB homologs and Lpp.

      We thank Reviewer #1 for this suggestion. We examined the distribution of Lpp-family proteins across closely related Enterobacteriaceae. While species such as Escherichia fergusonii, Shigella flexneri and Shigella dysenteriae encode Lpp and as well as a paralogous small lipoprotein (YqhH, see Fig.S7), we find that LppB-like orthologs (equivalent to lppB from Salmonella) appear to be restricted to Salmonella species to our knowledge. Because LppB shows this lineage-specific distribution, inclusion of a broader phylogenetic tree would primarily highlight its restricted presence rather that provide additional evolutionary insight. We will clarify this point in the revised manuscript.

      Increased expression of LppB under low pH is subtle. This result would benefit from quantifying the blots (Fig. S1) and performing statistical analysis.

      We thank Reviewer #1 for this observation. We agree that the increase in LppB levels at acidic pH appears modest. We will carefully reassess this result across independent experiments and, where technically appropriate, provide quantitative information to better document the magnitude of the effect. Additionally, we will revise the text to more accurately described the observed difference.

      Similarly, the SDS-EDTA sensitivity result (Fig. S2) is not convincing; the image doesn't seem to show isolated colonies at low pH (Fig. S2B). Please measure CFU/mL and report endpoint growth graphs instead. Statistical analysis should also be presented.

      We thank Reviewer #1 for this suggestion. We agree that the SDS-EDTA sensitivity assay presented in Fig. S2 could benefit from a more quantitative assessment. We will perform CFU/mL measurements from independent biological replicates to better quantify the observed differences and include statistical analysis when appropriate. In addition, we will revise the corresponding text to more accurately reflect the magnitude of the phenotype.

      The reduction to PG crosslinking of the C57R mutant is unclear (Fig 4B lane 22). The authors state: "suggesting that additional features of the LppB C-terminal region underlie its reduced efficiency." Does this mean additional amino acids play a role? Did the authors try to substitute Cys with other amino acid residues like Ala or Ser and quantify protein levels to find a mutant with similar expression levels? Do these have less crosslinking too?

      We thank Reviewer #1 for this important comment. As correctly noted, the reduced abundance of the LppB<sub>C57R</sub> variant likely contributes to its reduced level of peptidoglycancrosslinked species. Therefore, we cannot formally distinguish whether the reduced peptidoglycan crosslinking reflects decreased intrinsic crosslinking efficiency or simply reduced protein abundance and stability. We will revise the text to clarify this point and explicitly acknowledge this limitation. The C57R substitution was chosen because arginine is present at the equivalent position in the Salmonella LppA homolog, allowing us to assess the functional consequences of a naturally occurring sequence variation between Lpp-family members. While substitutions such as C57A or C57S could further dissect the specific contribution of the cysteine residue, our use of the C57R substitution provides direct insight into the functional implications of this naturally occurring difference between Lpp homologs.

      Reviewer #2 (Public review):

      Summary:

      The manuscript by Pierre Despas and co-workers, reports the biochemical characterization of LppB a peculiar Lpp (Braun's lipoprotein) homolog found in Salmonella enterica. S. enterica encodes two Lpp homologs LppA and LppB: while LppA and Lpp function similarly, the role of LppB is less clear. LppB shares with Lpp the Cterminal Lys needed for covalent attachment to peptidoglycan (PG) but diverges in residues that precede the terminal Lys featuring a Cys residue at the penultimate position. By using E. coli as a surrogate model, the authors show that LppB can be covalently linked to PG via the terminal Lys residues and that the penultimate Cys residue can be used to form homodimer species when expressed alone and heterotrimeric complexes when co-expressed with Lpp. Interestingly, LppB expressed in E. coli seems to be stabilized at acidic pH a condition Salmonella encounters in macrophage phagosomes. Finally, based on decreased intensity of LppB-PG crosslinked bands as LppB expression increases the authors suggest that LppB is able to negatively modulate the outer membrane-peptidoglycan connectivity.

      Strengths:

      The manuscript is interesting, describes a novel strategy employed by bacteria to fine tuning outer membrane-PG attachment and provides new insights into how envelope remodeling processes can contribute to bacterial fitness and pathogenicity.

      Weaknesses:

      The analysis and quantification of muropeptides formed in E. coli strains overexpressing LppB would strengthen the main conclusion of the manuscript.

      We thank Reviewer #2 for this insightful comment. We agree that quantitative analysis of muropeptides in E. coli strains expressing LppB would strengthen the main conclusion. This point was also raised in the editorial assessment and by Reviewer #3, underscoring its importance. In a revised version, we plan to perform muropeptide profiling by HPLC, coupled where appropriate to mass spectrometry, to quantitatively assess peptidoglycan composition in the relevant strains.

      Reviewer #3 (Public review):

      Summary:

      The manuscript is interesting, and it is clearly written. While the experiments are well executed, a general flaw is that the LppA/B analyses are done in the E. coli K12 host as surrogate for Salmonella enterica. For the mechanistic and molecular analyses of LppB a surrogate host is certainly adequate, yet it limits extrapolation of the physiological implications of LppB in the natural context. 

      Strengths:

      The work convincingly demonstrates that LppB forms disulfide-based dimers and that it is crosslinked to PG via LdtB in E. coli. Moreover, dimerization is required for LppB abundance in E. coli and LppB can inhibit crosslinking of Lpp/A to PG in E. coli. 

      Weaknesses:

      Regarding the key conclusion of the work: while it is shown that LppB is oxidized in E. coli, whether envelope integrity (or OMV production) changes arise from switches in oxidation of the LppB cysteines remains to be shown, for E. coli let alone in the native host Salmonella. Does expression of LppB influence Lpp/A activity or OM tethering in E. coli? Since the inhibition of the Lpp/A linking to PG is not affected by the oxidation state of LppB, the abstract/title implies redox-control of envelope integrity which is a bit misleading and an overstatement. Both are features of LppB: i.e. it dimerizes through disulfide bond formation and it reduces PG binding of Lpp/A through trimerization. However, no link between the two is shown.

      We thank Reviewer #3 for this important comment and for highlighting the need to clarify the relationship between LppB oxidation, oligomerization, and its effect on peptidoglycan crosslinking. We agree that while our data demonstrate that LppB forms disulfide-linked oligomers and that LppB expression reduces Lpp/A attachment to peptidoglycan, our current results do not establish a direct causal link between the oxidation state of LppB and its ability to modulate outer membrane–peptidoglycan tethering. Therefore, we will revise the manuscript to avoid implying redox-dependent control of envelope integrity and to more clearly present these as distinct but potentially related properties of LppB.

    1. eLife Assessment

      Foucault and colleagues examine how human adaptive learning depends on the structure of the learning task. The authors provide useful findings clarifying the differences in how people learn in environments that are continuously versus discontinuously changing. While they provide solid evidence for most conclusions, support for some of the claims is incomplete in the current form.

    2. Reviewer #1 (Public review):

      Foucault and colleagues examine how people's belief updating in a predictive inference task depends on qualitative differences in generative structure, in particular focusing on two generative structures frequently employed in learning and belief updating tasks (changepoints and random walks). While behavior and normative predictions for these structures have been explored many times in different tasks and settings, these exact structures have, to the best of my knowledge, never been explored in the same study and modeling framework for direct comparison. The authors use ideal observer models coupled with a response bias module to make predictions for what structure-appropriate adaptive learning would look like across the two conditions, then they ran an experiment to test behavioral predictions for the two structures under different levels of stochasticity. The authors present evidence that stochasticity changes in learning for two qualitatively different reasons, and that depending on which of these factors dominate, can have different effects on learning. They show that human participants showed qualitative trends consistent with adjusting their structural assumptions of the task to guide learning and adjusting their assessments of stochasticity.

      The experiment was well designed and executed, and the paper was well written. The findings from the study are largely consistent with other work in the field, but there are a few advances that go beyond previously established findings, most notably a nuanced examination of how stochasticity affects learning behavior, which has the potential to provide an explanation for a notable discrepancy in the field (Pulco and Browning 2025; Piray and Daw 2024). The paper has notable strengths in its use of computational models to generate qualitative predictions that are evaluated in empirical behavioral data.

      The current paper has a few weaknesses. It makes strong claims regarding the impacts of stochasticity on optimal learning that were difficult to evaluate, given a lack of clarity on the exact modeling that was implemented and incompletely supported by the existing analysis. The paper also lacks statistical support for some of its claims and evaluates models only through their ability to reproduce summary measures, rather than through direct model fitting.

    3. Reviewer #2 (Public review):

      Summary:

      The manuscript by Foucault, Weber, and Hunt examines human learning behavior across change-point and continuously changing environments. The authors suggest that humans normatively adjust their learning dynamics to the current environmental dynamics. Moreover, they argue that humans not only track the means of the outcome-generating process, but also the variance, which extends recent work in this domain. The present results suggest that human learners are well able to distinguish the two moments and adjust their behavior accordingly.

      Strengths:

      (1) The paper is clearly written, and the figures demonstrate the results well. The authors clearly explain the two key results and their implications for the field.

      (2) The paper uses a common modeling framework for the two environments. This makes it less likely that differences in learning behavior between the two environments are driven by general model properties rather than the specific learning mechanisms.

      Weaknesses:

      (1) Interpretation in terms of normative learning

      (1.1) Perseveration and paddle movement

      The model presented in the main manuscript is equipped with a response-probability mechanism that controls whether the paddle is updated. Especially on smaller prediction errors, the paddle is often not updated (perseveration). I wonder whether this mechanism truly reflects normative updating behavior or rather a heuristic strategy. Not moving the paddle is non-normative. A fully Bayesian model would hardly ever show a learning rate of exactly zero (one could argue only when the error is itself zero or after a massive amount of trials). This is partly apparent in Supplementary Figure 1, where the lowest learning rates are around alpha = 0.2 (change-point environment) and 0.5 (random walk).

      Supplementary Figure 1 shows the learning rate for the normative model without the response-probability mechanism. Primarily in the random-walk environment, but to some extent also in the change-point condition, the shape of the learning rate changes quite dramatically compared to Figure 4. In the random-walk environment, the learning rate appears relatively stable, with a value slightly larger than 0.5. In the change-point case, the learning rate is somewhat higher in the range of smaller prediction errors. Doesn't this speak against the interpretation that the model in the main manuscript is really behaving in a purely normative fashion? The tendency to perseverate might reflect a simplified strategy, which is sometimes described as "satisficing". That is, in line with the authors' description of the mechanism, perseveration occurs when it seems "good enough" (Simon, 1956), which has been demonstrated in a belief updating context before (Bruckner et al., 2025; Gershman, 2020; Nassar et al., 2021).

      Supplementary Figure 3 suggests that humans show quite a lot of this type of behavior. It indicates that in the change-point condition, in only 20% of the trials in the minimal prediction error range, participants update their prediction (i.e., in 80% of these trials, they perseverate on the previous prediction). This update probability increases as a function of the prediction error. In the random-walk condition, update probabilities are higher, starting at around 40% and also increasing as a function of the error.

      Indeed, Supplementary Figure 4 suggests that the shape of the learning rate for true update trials is much shallower for humans and the "perseverative" model compared to the model in Supplementary Figure 1. This suggests that the curve in Figure 4 (main manuscript), hinting at a continuous increase in the learning rate, could be the result of a mixture of perseveration (alpha = 0) and higher learning rates compared to the normative model without the response-probability mechanism.

      (1.2) Control models

      One might reply that the response-probability mechanism just adds noise, while the actual learning mechanism is still normative. However, a standard Rescorla-Wagner model with the same response-probability mechanism might also show increasing apparent learning rates as a function of prediction error (when perseveration trials and regular update trials are averaged as a function of the prediction error).

      Therefore, I suggest adding a control analysis with a Rescorla-Wagner model. One version with the same response mechanism yielding perseveration, and one standard Rescorla-Wagner model without this mechanism. This should help identify how well the present analyses can distinguish true learning-rate dynamics from averaging artifacts due to perseveration.

      (1.3) Discussion of the possibility of non-normative learning mechanisms

      Given the considerations above, I suggest a more balanced discussion of potential non-normative influences on learning, in particular, perseveration. Several previous papers have similarly shown that perseveration prominently characterizes human learning and decision-making (Bruckner et al., 2025; Gershman, 2020; Nassar et al., 2021), and in my opinion, it would be relevant to discuss how normative and non-normative mechanisms might jointly shape learning.

      (2) Model description

      The Bayesian model is quite central to the paper. However, the mathematical details are sparse, and I did not fully understand the differences between the model variants and how they were implemented. In particular, what approximations were used to make the model tractable? And how does the variance inference work? Is the learning rate directly computed, similar to the Nassar model, or is it derived from updates and prediction errors?

      (3) Apparent learning rates in humans

      The main learning-rate analyses compute the fraction of updates and prediction errors. For quality assurance, it would be useful to see a few supplementary histograms of the apparent learning rates. It would be great to have one plot across all participants and a few example plots for single participants. These analyses will reveal the distribution of learning rates and the proportion at the boundaries, which can sometimes be a source of bias.

      References:

      Bruckner, R., Nassar, M. R., Li, S.-C., & Eppinger, B. (2025). Differences in learning across the lifespan emerge via resource-rational computations. Psychological Review, 132(3), 556-580. https://doi.org/10.1037/rev0000526.

      Gershman, S. J. (2020). Origin of perseveration in the trade-off between reward and complexity. Cognition, 204, 104394. https://doi.org/10.1016/j.cognition.2020.104394.

      Nassar, M. R., Waltz, J. A., Albrecht, M. A., Gold, J. M., & Frank, M. J. (2021). All or nothing belief updating in patients with schizophrenia reduces precision and flexibility of beliefs. Brain, 144(3), 1013-1029. https://doi.org/10.1093/brain/awaa453.

      Simon, H. A. (1956). Rational choice and the structure of the environment. Psychological Review, 63(2), 129-138. https://doi.org/10.1037/h0042769.

    4. Reviewer #3 (Public review):

      Summary:

      This paper uses a single Bayesian modelling framework to derive specific predictions for making inference, either with assumptions of a change-point structure or a gradually changing structure across tasks.

      Strengths:

      The paper nicely summarizes the slightly different subliteratures that have studied human behavior with models that only assume a single underlying task structure. The diagnostic predictions from the models are presented clearly, and the human data are nicely consistent with the model predictions.

      As the authors discuss themselves, this work opens the door to many questions on the structured learning of inferring (from experience or verbal instructions) which meta-model is most appropriate to use.

      Weaknesses:

      Alignment between models and human behavior is mostly qualitative; the models are not fit to individual data (which could, for instance, uncover interesting differences between individuals.

      There is no consideration of the possibility that individuals may not fully use one or the other meta-model (of gradual change vs changepoints), but instead a hybrid. Fits of the models to data may help uncover if some people (e.g., the 10% in experiment 2 that were best matched by the CP model?) use a slightly different mix of strategies than the one suggested by the verbal instructions received (which may cause the pattern in Figure 6d, which looks to have featured both models).

    5. Author response:

      We thank the reviewers for their constructive feedback and careful evaluation of our manuscript. We are encouraged that the study was viewed as well designed and clearly presented, that its computational modeling approach was recognized as a strength, and that the key findings were appreciated. We agree that some claims would benefit from additional support and clarification. Below, we outline the main revisions we will undertake to strengthen the manuscript and address the points raised in the reviews. These revisions are intended to strengthen the evidential support for our conclusions and clarify aspects of the results and modeling.

      (1) Statistical support.

      Some claims were judged to lack sufficient statistical support [Reviewer 1]. In the revised manuscript, we will carefully review all inferential claims and ensure that they are supported by appropriate statistical analyses. Where necessary, we will implement additional statistical tests and expand statistical reporting to ensure that differences between conditions, models, or behavioral measures are formally evaluated and that key aspects of the data are appropriately described.

      (2) Modeling clarification.

      Some aspects of the modeling were considered insufficiently clear, particularly regarding how the models were implemented [Reviewers 1 and 2]. We will expand the Methods section to provide a clearer and more complete description of the Bayesian models and their implementation. In particular, we will clarify that full probability distributions were computed (without reduced approximations such as those used in simplified Bayesian variants), and that the only approximation concerns numerical discretization of continuous state spaces at fine resolution. We will clarify that variance is part of the joint multidimensional state space and is inferred jointly with the mean. We will also explicitly state that apparent learning rates are derived from predicted paddle responses in the same way as for participants, and are not directly computed within the Bayesian inference process.

      (3) Model fitting.

      The absence of direct model fitting to individual participants was identified as a limitation [Reviewers 1 and 3]. In response, we will implement individual-level model fitting (to the extent feasible in practice) and conduct formal model comparison based on the fitted models. We will further validate the fitted models by examining whether they reproduce the main behavioral signatures observed in the data.

      (4) Normative interpretation and control analyses.

      The interpretation of the models as normative was questioned in light of the response-probability mechanism [Reviewer 2]. In the revision, we will clarify the distinction between the normative inference component of the model and the response-level mechanism. We will revise the framing of the results accordingly and ensure that normative claims are restricted to the inference component. We will also expand the discussion to integrate relevant literature on perseveration and satisficing, and clarify how normative and non-normative mechanisms may jointly shape behavior. In addition, following the reviewer’s suggestion, we will include control analyses using standard Rescorla–Wagner models, with and without the response-probability mechanism, to evaluate whether the observed signatures can be accounted for by simpler learning rules.

      (5) Additional points.

      We will also address the additional points raised in the reviews. Specifically, we will include supplementary histograms of apparent learning rates [Reviewer 2]. We will provide additional clarification and analyses regarding the effects of stochasticity on learning [Reviewer 1]. Finally, we will explore hybrid or mixture models and strategies and expand the discussion of this possibility [Reviewer 3].

      We believe that these revisions will substantially strengthen the support for our claims and address the concerns raised in the current assessment. We are grateful for the reviewers’ engagement with our work and for their comments, which will allow us to significantly improve the clarity and strength of the manuscript.

    1. eLife Assessment

      This study offers a valuable analysis of how moment-to-moment fluctuations in arousal are associated with structured, non-uniform patterns of brain-wide functional connectivity during wakefulness. Using data-driven analyses of resting-state and naturalistic fMRI with eye tracking, the authors present convincing evidence that arousal is a dynamic, continuous process that shapes brain activity in a structured way beyond a simple global effect. However, the strength of the conclusions is limited by a reliance on specific analytical choices and the need for additional controls and robustness analyses. This paper sheds light on the link between brain activity and ongoing fluctuations in arousal and will be of interest to researchers studying large-scale brain functional organization and links between the brain and body.

    2. Reviewer #1 (Public review):

      Summary:

      In this study, the authors aim to characterize how moment-to-moment fluctuations in arousal during wakefulness shape large-scale functional brain connectivity. Using pupil diameter as an index of arousal and high-field functional imaging, they seek to determine whether arousal-related modulation of connectivity is uniform across the brain or organized into structured patterns, and whether such patterns show hemispheric asymmetry. The work further aims to assess whether these organizational features generalize across resting-state and naturalistic viewing conditions.

      Strengths:

      The study addresses an important and timely question regarding how spontaneous variations in arousal influence whole-brain communication during wakefulness. The dataset is rich, combining high-field imaging with concurrent physiological measurements, and the analyses are ambitious in scope. A key strength is the attempt to move beyond region-based effects and to describe arousal-related modulation at the level of large-scale connectivity organization. The comparison across rest and movie viewing provides useful context and suggests a degree of consistency across behavioral states.

      Weaknesses

      First, a central claim is that arousal modulates functional connectivity in a hemispherically asymmetric and community-specific manner. Although structured asymmetries are demonstrated at the group level, it remains unclear whether these effects reflect a stable neurobiological principle or arise from high-dimensional, connection-wise analyses that are sensitive to sampling variability. Given the interpretive weight placed on hemispheric lateralization, stronger evidence of robustness and individual-level consistency would be necessary to support this conclusion.

      Second, all analyses are based on ultra-high-field imaging. The manuscript does not address whether the reported arousal-related patterns, including the community structure and hemispheric asymmetries, are expected to be reproducible at standard field strengths. It therefore remains unclear whether the findings depend critically on the use of high-field data or whether they would generalize to more widely available datasets, limiting the broader applicability of the results.

      Third, arousal-connectivity coupling is assessed using zero-lag correlations between pupil diameter and time-resolved connectivity estimates. Physiological and hemodynamic considerations suggest that pupil-linked arousal and blood-based imaging signals may exhibit systematic temporal delays. The absence of analyses examining sensitivity to such delays raises the possibility that the reported coupling patterns depend on a specific temporal alignment assumption.

      Fourth, the estimation of time-resolved connectivity relies on a single choice of sliding-window length. The manuscript does not examine whether the reported patterns are stable across different window sizes. Given ongoing concerns about parameter dependence in time-resolved connectivity analyses, sensitivity analyses would be important to establish that the findings are not artifacts of a particular analytical choice.

      Finally, the identification of seven connectivity communities is a central result, yet the justification for this choice relies primarily on a single clustering quality measure. In practice, evaluation of clustering solutions typically draws on multiple complementary criteria, including measures of compactness and separation, approaches for selecting the number of clusters, and assessments of stability under resampling. Without such complementary evaluations, it is difficult to determine whether the reported community structure reflects a stable organizational feature or sensitivity to specific methodological decisions.

    3. Reviewer #2 (Public review):

      Summary:

      This manuscript addresses a clear and widely relevant question: how ongoing fluctuations in alertness during wakefulness relate to large-scale patterns of coordinated brain activity. The authors combine high-field magnetic resonance imaging with simultaneous pupil measurements, and they compute an edgewise measure of arousal-related coupling for every pair of regions. Their main contribution is to show that arousal-related coupling is low-dimensional and organized into seven reproducible "connectivity communities", each with characteristic network pair compositions. A secondary contribution is the observation that these communities exhibit systematic but community-specific hemispheric asymmetries, including a striking left/right dissociation within the ventral attention network, where the left side participates broadly across communities while the right side forms a more cohesive, segregated arousal-responsive module. A final contribution is cross-context generalization: the same organizational structure and lateralization signatures are largely preserved during naturalistic movie watching.

      Strengths:

      (1) The paper moves beyond state contrasts and quantifies arousal-related modulation continuously within wakefulness, directly addressing a gap highlighted in the Introduction.

      (2) The hemispheric asymmetry result is not framed as a crude global dominance effect; the authors explicitly test and argue that the key signal lies in structured spatial heterogeneity rather than mean shifts.

      (3) The cross paradigm replication in movie watching is a strong design choice and supports the claim that the organizational motifs are not limited to unconstrained rest.

      Weaknesses:

      (1) Arousal effects on BOLD signals and on pupil size can have different delays, so it would be valuable to test lagged relationships (for example, shifting the pupil series forward and backward) to show that the main community structure and lateralization results are not sensitive to an arbitrary temporal alignment.

      (2) Pupil diameter covaries with blinks, eye closure, and other factors that can covary with head motion and physiological noise. The Methods include substantial quality control and denoising, including motion regression and scrubbing, plus exclusions for eye closure.

      (3) The dataset is described in terms of runs retained (for example, 485 resting runs), and runs are treated as observations in clustering after z-scoring across runs. If multiple runs come from the same individuals, the manuscript would benefit from explicitly showing that results replicate at the participant level (for example, community structure stability within participant across runs, and participant-level summary statistics used for inference), rather than relying primarily on pooled run-level patterns.

      (4) Time-resolved connectivity is estimated using a 30-second sliding window and 5 second step. It is reasonable to wonder whether the same conclusions hold with alternative estimators that do not rely on fixed windows. The Discussion acknowledges this limitation, but adding a small robustness analysis would make the paper more definitive.

    4. Reviewer #3 (Public review):

      Summary:

      The paper investigates neural fluctuations underlying arousal using a combination of resting state/naturalistic movie watching fMRI and eye tracking data. The authors have used several data-driven approaches, including time-varying sliding window analyses and clustering methods, to characterize large-scale brain organization and hemispheric asymmetries associated with arousal fluctuations. This is an interesting study framing arousal as a dynamic, continuously varying process rather than a discrete state. Overall, the manuscript is well written and provides sufficient methodological and analytical detail accompanied by an explanation of results. However, several conceptual and methodological issues require clarification or further discussion to strengthen the interpretation and robustness of the findings.

      Strengths:

      This is an interesting study framing arousal as a dynamic, continuously varying process rather than a discrete state. Overall, the manuscript is well written and provides sufficient methodological and analytical detail accompanied by an explanation of results.

      Weaknesses:

      (1) A major limitation of the study is the limited discussion of subcortical regions, which play a central role in arousal regulation according to extensive prior literature. Although the current analyses focus primarily on cortical organization, the authors should include a brief discussion of how their findings relate to subcortical arousal systems.

      (2) While sliding window methods can capture temporal changes in functional organization, they have limitations in characterizing moment-to-moment neural fluctuations. In particular, results can be highly sensitive to window length and step size. The manuscript would benefit from (a) a clearer discussion of these methodological limitations, (b) justification for the chosen window length and step size, and (c) a sensitivity analysis demonstrating whether the main findings are robust across different parameter choices.

      (3) The authors use k-means clustering to identify groups of brain regions and refer to these groupings as "communities." However, in general, community detection typically refers to graph-based algorithms that identify modules based on connectivity structure (e.g., modularity maximization). The clusters derived from k-means in feature space are not necessarily equivalent to graph-theoretic communities. The authors should explicitly clarify this distinction and adjust terminology accordingly to avoid conceptual ambiguity.

    1. eLife Assessment

      The new development of Neuroplex, a pipeline that links projection-defined neuronal identity to in vivo calcium activity within the same animal, is a valuable contribution to the field of neuroscience and beyond. The strength of evidence is judged to be solid, as the methods, data, and analyses broadly support the stated claims.

    2. Reviewer #1 (Public review):

      Genetically encoded fluorescent proteins expressed in specific cell types allow recognising them in vivo and, if the protein is a functional indicator, as in the case of genetically encoded calcium indicators (GECIs), to record activity from the same cellular ensemble. Ideally, if proteins (fluorophores) have perfectly distinct spectral properties, signals can be distinguished from as many cell types as the number of employed fluorophores. In practice, fluorescent proteins have non-negligible crosstalk both in absorption and emission bands. In addition, fluorescence contribution of each fluorophore normally varies from cell to cell and therefore spectral properties of cells expressing two or more proteins are different. The work of Phillips et al. addresses this challenge. The authors present an approach defined as "Neuroplex", allowing identification of up to nine cell types from the same number of fluorophores. The fingerprint of each cell is then associated with functional fluorescence from the GECI GCaMP, allowing recording calcium activity from that specific cell. The method is implemented in vivo using head-mounted miniscopes.

      The authors used a mouse line expressing GCaMP in cortical pyramidal neurons and developed an experimental pipeline. First, they injected the nine AAV viruses, causing expression of fluorophores in a different brain area. The idea was not to image that area, but a non-infected medial prefrontal cortex (mPFC) section where neurons could be infected by their axons projecting in an injected area, in this way being identified by their targeting region(s). A GRIN lens, allowing spectral analysis, was mounted in the mPFC section, and GCaMP fluorescence was then recorded during behavioural tasks and analysed to identify regions of interest (ROIs) corresponding to neuron somata. After functional imaging, the head of the mouse was fixed, spectral analysis was performed, and after necessary correction for chromatic distortions, the fluorophore contribution was determined for each ROI (neuron) from where GCaMP signals were detected. Notably, the procedures for estimation and correction of chromatic aberration and light transmission (described in Figure 2) were a major challenge in their technical achievements. The selection of the nine fluorophores was another big effort. This was done by combining computer simulations and direct measurement of spectra from individual proteins expressed in HEK293 cells. It is important to say that the authors could simulate arbitrary combinations of two or more different fluorophores and evaluate the ability of their algorithm to detect the correct proteins against wrong estimations of false-negative (absence of an expressed protein) or false-positive (presence of a non-expressed protein). Not surprisingly, this ability decreases with the level of GCaMP expression. The authors underline that most errors were false-negatives, which have a milder impact in terms of result interpretation, but the rate of false positives was, nevertheless, relevant in detecting a second fluorophore from a cell expressing only one protein. The experimental profiles of fluorophores were dependent both on the specific fluorescent protein and on the projecting area, and the distribution of double-labelled did not match anatomical evidence. This result should be taken as the limitation of the present pioneering experiments, presented as proof-of-principle of the approach, but Neuroplex may provide far improved precision under different experimental conditions.

      In my view, the work of Phillips et al. represents a significant advance in the state-of-the-art of the field. The rigorous analysis of limitations in the use of Neuroplex must be considered an important guideline for future uses of this approach.

    3. Reviewer #2 (Public review):

      Summary:

      The manuscript introduces Neuroplex, a pipeline that integrates miniscope Ca²⁺ imaging in freely moving mice with multiplexed confocal and spectral imaging to infer projection identities of recorded neurons. This technical approach is promising and could broaden access to projection-resolved population imaging. However, the core quantitative analyses apply a winner-take-all single-label assignment per neuron even when multiple fluorophores exceed threshold, with additional labels treated descriptively as "secondary hits." While the authors acknowledge and simulate dual labeling, the extent to which this single-label decision rule affects subtype fractions and behavioural comparisons remains uncertain without a multi-label (or probabilistic) sensitivity analysis and propagation of classification uncertainty.

      Strengths:

      (1) Conceptual advance and practicality: Decoupling acquisition from identity readout constitutes an innovative approach that is, in principle, applicable in laboratories currently using single-color miniscopes.

      (2) Engineering thoroughness: The manuscript offers detailed consideration of GRIN optics, spectral libraries, registration procedures, and simulations that address signal-to-noise ratio, background, and class imbalances.

      (3) Immediate community value: If demonstrated to be robust, the pipeline could enable projection-resolved analyses without reliance on specialized multicolor miniscopes.

      Weaknesses:

      (1) Single-label assignment in the main analyses: When multiple fluorophores exceed threshold for a neuron/ROI, the workflow applies a winner-take-all rule and assigns a single label (the fluorophore with the largest standardized beta), while additional above-threshold fluorophores are retained only as "secondary hits." This is a reasonable specificity-first choice, but because cortical excitatory neurons can collateralize, collapsing dual-threshold ROIs to one identity may under-represent dual-projecting cells and could bias estimated subtype fractions and behavioural comparisons.

      (2) Dual-label detection is acknowledged but remains descriptive in vivo: the manuscript explicitly discusses the possibility of dual projection, evaluates dual-fluorophore detection in simulations (including performance under realistic noise/background), and reports in vivo rates of secondary hits. However, these dual-threshold events are not incorporated as co-identities in the main statistical analyses, making it difficult to judge how robust the principal biological conclusions are to the single-label decision rule.

      (3) Uncertainty is not propagated: False-positive/false-negative rates from simulations and uncertainty from registration/segmentation are not carried forward into quantitative confidence bounds on subtype proportions or behaviour-by-subtype effects.

    4. Reviewer #3 (Public review):

      This manuscript presents Neuroplex, a technically rigorous and carefully validated pipeline that links miniscope calcium imaging in freely behaving animals with high-dimensional fluorophore-based cell-type identification using in vivo multiplexed spectral confocal imaging through the same implanted GRIN lens. The work overcomes a major practical limitation of head-mounted microscopy by enabling the identification of up to nine projection-defined neuronal populations within the same animal, without post-fixation histology. The approach is well motivated and supported by extensive calibration and simulation. While the biological results are primarily illustrative, the methodological contribution is clear and likely to be broadly useful.

      Major comments

      (1) The approach relies on the assumption that fluorophore identity assigned during anesthetized confocal imaging accurately reflects the identity of neurons recorded during prior behavioural sessions. While the use of the same GRIN lens and in vivo co-registration mitigates many concerns, the manuscript would benefit from a more explicit discussion, or empirical demonstration, if available, of the stability of fluorophore assignments across time. Even limited repeat spectral imaging in a subset of animals would strengthen confidence in longitudinal applicability.

      (2) Fluorophore identity is determined using thresholding of linear unmixing coefficients relative to an empirically defined baseline, followed by a second adaptive pass for over-represented fluorophores. While this heuristic is extensively validated via simulations, it remains ad hoc from a statistical perspective. The authors should more explicitly justify this choice and discuss its limitations relative to probabilistic or likelihood-based classifiers, particularly with respect to uncertainty estimation at the single-ROI level.

      (3) Identifiability of fluorophores is demonstrated empirically, but the manuscript does not explicitly quantify spectral separability (e.g., similarity metrics between basis spectra or conditioning of the unmixing matrix). A brief analysis of spectral independence or sensitivity of beta estimates to noise would provide mathematical reassurance, especially given the reliance on linear regression in a high-dimensional feature space.

      (4) The spectral unmixing treats CNMF-derived ROIs as fixed supports. I wonder whether ROI boundaries, neuropil contamination, and partial overlap can introduce structured uncertainty that could bias spectral estimates. If so, the authors should acknowledge this dependency more explicitly and discuss how ROI quality or overlap might influence false negatives or false positives, particularly in densely labelled regions.

      (5) The manuscript reports meaningful rates of secondary fluorophore detection, but also nontrivial false-positive rates for secondary labels under realistic conditions. The authors appropriately caution against over-interpretation, but the Discussion should more clearly delineate when dual-label assignments are likely to be biologically interpretable versus methodologically ambiguous, and how experimental design (e.g., fluorophore pairing) should be optimized accordingly.

      (6) I suspect that Neuroplex will be most effective in certain regimes (moderate convergence, bright and spectrally distinct fluorophores) and less reliable in others. A more explicit discussion of best practices, anticipated failure modes, and experimental scenarios where the method may be inappropriate would increase the practical value of the paper for adopters.

    1. eLife Assessment

      This important study describes long-range serial dependence of performance on a visual texture discrimination training task that manipulated conditions to induce differing degrees of location transfer of learning. The authors re-analyzed a previously-published behavioral data set, generating compelling evidence from converging approaches that serial dependence effects can persist across multiple days post-training, and are impacted by whether training promotes more or less location transfer. Although underlying mechanisms for these processes remain unclear, these results will interest neuroscientists in general by informing our understanding of the importance of temporal integration to long-term perceptual learning and its propensity towards specificity or generalizability.

    2. Reviewer #1 (Public review):

      This paper presents a reanalysis of a large existing dataset to examine whether serial dependence effects-systematic influences of recent stimulus history on current perceptual judgments-are associated with generalization in perceptual learning. The central hypothesis is that extended, longer-range history effects (beyond the most recent trials) are beneficial for transfer across locations. The authors reanalyze data from a texture discrimination task in which observers discriminated peripheral target orientation against a line background, with performance quantified by stimulus-onset asynchrony thresholds. Three training conditions were compared: a fixed single-location condition, a two-location alternating condition, and a dummy-trial condition with frequent target-absent trials. Transfer was assessed after training at new locations. Serial dependence was quantified using history-sequence analyses and linear mixed-effects models estimating bias weights across stimulus lags, with summary measures distinguishing recent (1-3 trials back) and more distant (4-6 trials back) dependencies.

      The authors report extended serial dependence effects, persisting up to 6-10 trials back, with substantial cumulative bias that remains stable across multiple days of training and is not correlated with overall performance thresholds. Recent history effects are stronger for faster responses, suggesting a contribution from decision- or response-related processes, whereas more distant effects decline within sessions, potentially reflecting adaptation dynamics. Critically, longer-range serial dependence is significantly stronger in training conditions that promote generalization than in the single-location condition. Individual differences in the strength and decay profile of distant history effects predict the magnitude of transfer across locations, whereas recent history effects do not. History effects are also correlated across trained locations, suggesting stable individual differences.

      The authors interpret longer-range serial dependence as reflecting integrative processes that extract task-relevant structure over time, thereby supporting generalization, while shorter-range effects are attributed to more transient mechanisms such as priming or decision-level bias. The discussion connects these findings to Bayesian accounts of perceptual stability and to concepts of overfitting in machine learning.

      The study offers a novel and thoughtful link between short-term serial dependence and long-term generalization in perceptual learning, helping bridge two literatures that are often treated separately. The large dataset enables robust estimation of individual differences, and the use of mixed-effects modeling appropriately accounts for variability across observers. The empirical distinction between recent and more distant history effects is well-supported and adds important nuance to interpretations of serial dependence. Converging evidence from both group-level comparisons and individual-level correlations strengthens the central conclusions.

      Several limitations should be addressed. First, the study relies entirely on previously collected data, without experimental manipulations designed to selectively isolate serial dependence mechanisms. Filtering choices, while theoretically motivated, may amplify history effects in ways that are difficult to quantify. Second, sequential dependencies can arise from multiple sources, including gradual updating of internal weight structures, adaptation processes, and history-dependent biases in decision-making. The current analyses do not clearly separate these contributions, limiting mechanistic attribution of long-range effects. Third, the conclusions are based on a single perceptual task, leaving open questions about generality across paradigms. Finally, while the discussion references computational ideas, no explicit modeling is provided to test whether plausible learning rules can jointly account for the observed history profiles and transfer effects.

      The findings align with theoretical frameworks that conceptualize perceptual learning as gradual reweighting of stable sensory representations at the decision stage (e.g., Petrov et al., 2005). Trial-by-trial updates in these models naturally give rise to sequential dependencies and sensitivity to training statistics. The observation that longer-range history effects predict generalization is consistent with broader temporal integration supporting more flexible learning, while narrower integration may lead to specificity. The results also indicate that multiple mechanisms - including decision-level biases and adaptation - may coexist with reweighting processes, highlighting the value of hybrid accounts.

      In summary, this is a careful and data-rich reanalysis that highlights a potentially important role for serial dependence in enabling generalization during perceptual learning. While the underlying mechanisms remain underspecified, the evidence supporting the reported associations is strong, and the work provides a valuable empirical foundation for further experimental and modeling efforts.

    3. Reviewer #2 (Public review):

      This manuscript investigates how people's perceptual reports are influenced by events and trials in the past, and how this long-range dependence relates to broader learning across locations in a visual learning task. The authors present clear and internally consistent analyses showing that extended temporal integration is associated with greater generalization of learning. The study is thought-provoking and may contribute meaningfully to understanding how short-term influences and long-term improvement interact, although several interpretational points would benefit from clarification.

      Strengths:

      (1) The manuscript identifies unusually long-range perceptual biases extending up to ten trials back, which is a striking and potentially important finding.

      (2) The association between strong long-range dependence and greater learning generalization is clearly documented and supported by consistent analyses.

      (3) The dataset is large and rich, and the authors apply repeated and well-controlled analyses that give confidence in the stability of the effects.

      (4) The writing is generally clear, and the manuscript raises interesting conceptual links between temporal integration and generalization of learning.

      Weaknesses / Points Requiring Clarification:

      (1) The manuscript repeatedly equates generalization with increased efficiency, but this relationship is not universally true. In some populations or tasks, excessive generalization can reduce task-specific efficiency. The authors should discuss this context-dependence to clarify when generalization is beneficial versus detrimental.

      (2) Serial dependence is also present, though smaller, in the central fixation task. It remains unclear whether this bias could contribute to the serial dependence observed in the main task. The authors should clarify whether the two biases are independent or whether the central-task bias might partially influence orientation judgments in the main task.

      (3) Several figure captions and labels contain minor inconsistencies in formatting and terminology. Careful proofreading would improve clarity.

    4. Reviewer #3 (Public review):

      This reanalysis of a classic study of visual perceptual learning in a texture discrimination task convincingly demonstrates the presence of sequential dependence effects, commonly seen in response time analyses in 2-alternative tasks, on response accuracy in the texture task in the visual periphery and in a simultaneous central letter report at fixation. Overall, this paper provides a new and interesting analysis of the effects of sequential dependencies from trial to trial on performance, learning, and generalizability in perceptual learning.

      Strengths:

      This new analysis of sequential dependency effects (SDEs) extends commonly observed sequential effects in two-choice reaction times to accuracy and relates them to response accuracy during visual learning in a frequently used perceptual learning task. The paper makes a convincing case that different conditions known to impact generalization of learning to a second visual location also express quantitatively distinct n-back SDEs.

      Weaknesses:

      Most of the new analyses emphasize the effects of SDEs, including trials designed to enhance the size of the effects, specifically when the current trial is low visibility, and the prior trial is of high visibility. Unless there is an argument that learning and subsequent generalization primarily occur in low-visibility trials, the presentation should also include displays and an emphasized discussion of analysis for all trials, unfiltered.

    1. eLife Assessment

      This study provides valuable evidence regarding our expectations about task difficulty and how this might influence proactive attention. The findings suggest that anticipated demands enhance the strength of attentional selection at cued locations. The evidence is solid but not definitive, as the conclusions rely on the absence of changes in spatial breadth and would benefit from clearer statistical justification and a more cautious interpretation of alternative mechanisms.

    2. Reviewer #1 (Public review):

      Summary:

      The authors attempt to use a combination of behavioural and EEG analyses in order to investigate whether expectation of task difficulty influences spatial focus narrowing in the context of a spatially cued task, alongside an expected attention-related amplitude effect. This distinguishes the experiment from previous tasks, which looked at this potential spatial narrowing in the context of more non-cued diffuse attention tasks. The authors present two major findings:

      (1) Behaviourally, they analysed the effects of cue validity and difficulty expectation on response accuracy, and found that participants displayed an effect of difficulty expectation in validly cued trials, showing relatively enhanced behaviour to Hard Expectation trials, but no effect of expectation in invalidly cued trials.

      (2) Inverted encoding modelling on broadband EEG showed greater pre-target attentional processing in the Hard Expectation blocks. They go on to show that this enhancement comes in the form of greater amplitude of the Channel Tuning Functions (CTFs) approximately 300 to 400ms post-cue, in the absence of any spatial tuning specificity enhancement (as would be evident in a difference in CTF fit width).

      Together, these results provide valuable findings for those investigating the separable effects of expectation and attention on target detection in visual search.

      Strengths:

      (1) This is a very solidly performed experiment and analysis, with different streams of evidence convincingly pointing in the same direction, i.e. a gain effect of Expectation in the absence of a spatial tuning effect.

      (2) EEG is competently analysed and interpreted, and the paper is well written and simple in its motivation.

      (3) The authors report appropriately on the results in the Discussion, without overreaching.

      Weaknesses:

      I mainly have a few minor issues for the authors to clarify, which I will leave to Recommendations. However, a few analyses need further work:

      (1) The GLMM method used has very large degrees of freedom (pages 6 and 7) of 34542. I assume this is the number of trials minus the number of parameters? This would imply that random slopes were not modelled in the analyses. However, looking at the Methods, it is reported that they were modelled. The authors should clarify exactly what was done here and why, including the LMM model.

      (2) Figure 4 shows an "example CTF fit". Why only one? You could put transparent lines in the background for each individual fit, followed by the grand average, or show each fit in the supplementary section?

    3. Reviewer #2 (Public review):

      Summary:

      The authors set out to determine whether people can adjust how narrowly or broadly they focus attention in advance based on expectations about how difficult an upcoming visual task will be. Specifically, they aimed to test whether expecting a more demanding search leads to a narrower focus of attention or instead strengthens attention at the relevant location without changing its spatial extent.

      Strengths:

      The study addresses a timely and interesting question about how expectations influence the preparation of attention before a task begins. The experimental design is well-suited to isolating anticipatory effects by manipulating expectations about task difficulty independently of moment-to-moment stimulus information. The manuscript is clearly written, and the methods are described in sufficient detail to support transparency and reproducibility.

      Weaknesses:

      Despite the strengths of the design and the merit of the work, I have a few concerns regarding the analysis and the interpretation of the results.

      (1) I was somewhat confused by aspects of the behavioural analysis. I may be mistaken, but fixed effects in generalised mixed-effects models are more commonly reported using Wald statistics with beta coefficients rather than F statistics, and the very large degrees of freedom reported here are difficult to interpret. In particular, they appear closer to trial counts than to the number of participants, which raises questions about how statistical uncertainty is being estimated. This concern is compounded by the fact that different statistical approaches appear to yield different conclusions: the generalised mixed-effects models and the pairwise t-tests reported in the figure caption do not fully align. Moreover, the latter are not described in the Methods, and the justification for using them in the figure is not provided. Taken together, this makes it difficult to assess the strength of the behavioural evidence. The reported effects of expectation on behaviour also appear small, and there is no clear cost at uncued locations. This limited behavioural footprint makes it difficult to determine how robust the proposed preparatory mechanism is. It also complicates the interpretation of the neural findings as reflecting a general strategy for optimising task preparation.

      (2) A central premise of the study is that, if observers proactively narrow their attentional focus when expecting difficult search, this should be reflected in sharper spatial tuning profiles. This prediction is presented as a diagnostic test of whether expectations modulate attentional scope. However, the absence of such sharpening is later taken as evidence that expectations do not alter spatial extent and instead operate exclusively through gain modulation. This inference may be stronger than the data allow. The lack of an observed difference in tuning width does not necessarily rule out changes in attentional scope, particularly if such changes are subtle, temporally limited, or not well captured by the spatial resolution of the approach. As a result, while the findings are consistent with a gain-based account, they do not definitively exclude the possibility that expectations also influence spatial extent, and the logic linking the original prediction to the final conclusion would benefit from a more cautious interpretation.

      (3) The difference between easy and hard searches in the CTF slope is taken as evidence for enhanced preparatory spatial attention under high expected difficulty. However, these differences could also reflect broader changes in alertness or motivational state between blocks. The behavioural results show a small overall increase in accuracy in expect-hard blocks, which may be consistent with a more general increase in task engagement rather than a spatially specific preparatory mechanism. Although the authors decompose slope differences into amplitude and width parameters, the interpretation still relies on ruling out alternative, more global explanations for enhanced signal strength or reduced variability. This leaves some ambiguity as to whether the observed modulation reflects a specific adjustment of preparatory attention or a more general change in task state.

    1. eLife Assessment

      This useful manuscript addresses a stability issue for long-term chronically implanted array recordings and electrolytic lesioning, which is relevant to both basic science and translational research. The authors provide a systematic scanning electron microscopy (SEM) of explanted arrays, evaluating electrode damage and sharing extensive datasets accessible through interactive plots. The strength of the evidence is solid, but it can be improved by performing additional analyses on complementary neurophysiology, functional, or histological data.

    2. Reviewer #1 (Public review):

      Summary:

      This work presents a GUI with SEM images of 8 Utah arrays (8 of which were explanted, and 4 of which were used for creating cortical lesions).

      Strengths:

      Visual comparison of electrode tips with SEM images, showing that electrolytic lesioning did not appear to cause extra damage to electrodes.

      Weaknesses:

      Given that the analysis was conducted on explanted arrays, and no functional or behavioural in-vivo data or histological data are provided, any damage to the arrays may have occurred after explantation, making the results limited and inconclusive (firstly, that there was no significant relationship between degree of electrode damage and use of electrolytic lesioning, and secondly, that electrodes closer to the edge of the arrays showed more damge than those in the center).

      Overall, these results add new data and reference images to the field, although the insights that can conclusively be drawn are limited due to the low number of electrodes used and lack of in-vivo/ histological/ impedance data.

    3. Author response:

      The following is the authors’ response to the original reviews.

      Public Reviews:

      Reviewer #1 (Public review):

      Summary:

      This work presents a GUI with SEM images of 8 Utah arrays (8 of which were explanted, and 4 of which were used for creating cortical lesions).

      Strengths:

      Visual comparison of electrode tips with SEM images, showing that electrolytic lesioning did not appear to cause extra damage to electrodes.

      Weaknesses:

      Given that the analysis was conducted on explanted arrays, and no functional or behavioural in vivo data or histological data are provided, any damage to the arrays may have occurred after explantation. This makes the results limited and inconclusive (firstly, that there was no significant relationship between degree of electrode damage and use of electrolytic lesioning, and secondly, that electrodes closer to the edge of the arrays showed more damage than those in the center).

      We agree insofar as we could not fully control the circumstances of each array during explantation. However, array explantation is potentially damaging, but not universally damaging, as demonstrated by some largely intact arrays in this paper. If electrolytic lesions were damaging to the array, they would be observed. All arrays examined in this paper were carefully stored as described in the paper. All analyses of this type require an explant surgery [?????]. Our conclusions remain as strong as any of the results of these analyses.

      Overall, these results do not add new insight to the field, although they do add more data and reference images.

      We respectfully disagree, as there is no extant SEM analysis on electrode arrays used for lesioning.

      Reviewer #2 (Public review):

      In this study, the authors used scanning electron microscopy (SEM) to image and analyze eleven Utah multielectrode arrays (including eight chronically implanted in four macaques). Four of the eight arrays had previously been used to deliver electrolytic lesions. Each intact electrode was scored in five damage categories. They found that damage disproportionately occurred to the outer edges of arrays. Importantly, the authors conclude that their electrolytic Lesioning protocol does not significantly increase material degradation compared to normal chronic use without lesion. Additionally, the authors have released a substantial public dataset of single-electrode SEM images of explanted Utah arrays. The paper is well-written and addresses an important stability issue for long-term chronically implanted array recordings and electrolytic lesioning, which is relevant to both basic science and translational research. By comparing lesioning and non-lesioning electrodes on the same array and within the same animal, the study effectively controls for confounds related to the animal and surgical procedures. The shared dataset, accessible via interactive plots, enhances transparency and serves as a valuable reference for future investigations. Below, we outline some major and minor concerns that could help improve the work.

      Major concerns:

      (1) Electrode impedance is a critical measurement to evaluate the performance of recording electrodes. It would be helpful if the authors could provide pre-explant and post-explant impedance values for each electrode alongside the five SEM damage scores. This would allow the readers to assess how well the morphological scores align with functional degradation.

      We agree, electrode impedance is very important in determining electrode performance. However, due to the multi-year, multi-subject nature of this work, we unfortunately do not have this data.

      (2) The lesion parameters differ across experiments and electrodes. It would be helpful if the authors could evaluate whether damage scores (and/or impedance changes) correlate with total charge, current amplitude, duration, or frequency.

      Thank you for this recommendation. We have included additional analyses in Supplementary Materials.

      Recommendations for the authors:

      Reviewer #1 (Recommendations for the authors):

      (1) ‘Both in vitro and in vivo testing of electrode arrays revealed environmental damage to these materials, such as cracking, textural defects, and degradation in response to the brain’s temperature and salinity [32]. The immune response of the brain also damages the electrodes due to effects like glial scarring (gliosis) and inflammation [33, 34]. This damage may be exacerbated by the surgical techniques used during implantation, which include pushing the electrode array into cortex and tethering the implant to the skull [33, 35, 36].’

      In the above text, several relevant references have been left out, e.g.:

      Barrese et al., 2013

      Patel et al., 2023

      Woeppel et al, 2021

      Chen et al., 2023

      Bjanes et al., 2025

      Thank you for this recommendation. This section has been updated.

      (2) ‘Aggressive electrical stimulation is known to dissolve platinum-based electrodes [37, 38]. Other studies have shown iridium oxide to be more resistant to stimulation-related damage, but not completely insusceptible [39, 40].’ Reference number 25 is relevant here.

      Thank you for this recommendation. This section has been updated.

      (3) ‘F’s and C’s PMd arrays were used for electrolytic lesioning experiments Monkey U was implanted with three 96-channel arrays; two in M1 and one in PMd.’ There seems to be a punctuation mark missing.

      Thank you for this recommendation. This section has been updated.

      (4) Methods: How much charge was injected via the electrodes that were used for lesioning? What current amplitudes, voltages, durations, and number of pulses were used? If more than 1 pulse was applied, what were the frequencies? Was the pulse cathode-only/ anode/only? What were the electrode impedance values at the time of stimulation? How many electrodes were used for lesioning at any given moment? How long after lesioning did the arrays remain in the tissue?

      Thank you for your questions. An additional supplemental table (Supplemental Table 6) detailing specific NHP lesions parameters has been added. A summary of the lesion procedure (DC, bipolar, two electrodes at a time) has also been included in Methods. All arrays remained in the subject until explant, which ranged between hours (same-day lesion and explant) to several years. Further details on the lesioning procedure are available in citation [?]. Explant dates are available in Supplemental Table 1. Unfortunately, we do not have the impedance values at time of lesioning as this is not a measure we record frequently after implant, though we agree the data would be useful to have.

      (5) Caption for Figure 1: ‘All array images are displayed with the wire bundle to the right side.’ I recommend adding this text from Figure 2 to the caption of Figure 1: ’electrode tips facing viewer’.

      Thank you for this recommendation. This section has been updated.

      (6) ‘Electrodes used for electrolytic lesioning are denoted with blue dots.’ Was stimulation carried out across all these electrodes simultaneously?

      No, stimulation was not carried out across all electrode simultaneously. Pairs of electrodes were stimulated at the same time to create lesions. Lesions were performed on different days. We have updated our methods section to reflect this. See the Methods section and citation [?] for more details.

      (7) For the control array, in Figure 1: ‘Click each column to view a close-up of the 5th row (from top to bottom) of electrodes:’ . It would be clearer to state: ’Click each column to view a close-up of a single electrode in the 5th row (from top to bottom):’.

      Thank you for this recommendation. This section has been updated.

      (8) Figure 2 caption: ‘Blank electrodes and electrodes with shank fractures are ignored and displayed in black, as they are not scored.’. What is a ‘blank’ electrode?

      A ‘blank’ electrode is an electrode on the array that physically exists but is not wire bonded at time of manufacture to produce recordings. The corner electrodes of the Utah array are all blank electrodes. We have updated this wording to ‘unwired’ for clarity.

      (9) I recommend incorporating Supplementary Figure 1 into Figure 2, so that the reader can immediately see where the rings are, without referring to the Supplementary Materials.

      Thank you for this recommendation. We have chosen to keep these figures separate for stylistic reasons.

      (10) Supplementary Figures: The figures should have the word ’Supplementary’ in the title, i.e., ‘Supplementary Figure X,’ not just ‘Figure X.’

      Thank you for this recommendation. These captions have been updated.

      (11) Throughout the results, the text is overly focused on the type of statistical test used and the p-values, e.g.: ‘When comparing lesioning and non-lesioning electrodes within the same array, each of the two nonparametric statistical tests (Mann-Whitney U-test, Levene Test) returned insignificant p-values for each category of damage as well as for total damage scores for all four arrays used in lesioning experiments.’.

      To make the findings more digestible for the reader, the text should be rephrased in terms of whether the metrics being compared were significantly different or not. E.g.: ‘For each category of damage, as well as for the total damage score, no significant difference was found between electrodes that were or were not used for lesioning (either the mean or the variance of the scores).’.

      Thank you for this recommendation. We have rephrased the text to reflect this note.

      (12) ‘In Monkey H, the Mann-Whitney U test resulted in an insignificant p-value for coating cracks and parylene C delamination scores, while the Levene test resulted in an insignificant p-value for abnormal debris, coating cracks, and parylene C cracking scores. In Monkey F, the Mann-Whitney U test resulted in an insignificant p-value for parylene C delamination scores, while the Levene test resulted in an insignificant p-value for coating cracks, parylene C delamination, and parylene C cracking scores. In Monkey U, the Mann-Whitney U test resulted in significant p-values for all scores, while the Levene test resulted in an insignificant p-value for abnormal debris, tip breakage, and coating cracks scores. Finally, in Monkey C, the Mann-Whitney U test resulted in an insignificant p-value for parylene C delamination and parylene C cracking scores, while the Levene test resulted in an insignificant p-value for abnormal debris, parylene C delamination, and parylene C cracking scores.’

      To point out another example, this chunk of text is highly repetitive and is unnecessary, as the reader can simply refer to Supplementary Table 4. It should be completely rephrased and summarized, to deliver the key message, i.e. briefly describe what kinds of damage occurred for which arrays. Also, what is the point of the two statistical tests? What are the authors trying to conclude?

      Thank you for this recommendation. We have rephrased and pared down the text to reflect this note.

      (13) Discussion: ‘Similarly, other work did not show significant differences in SEM-visible degradation between both platinum and iridium oxide coated electrodes used for stimulation [24, 25].’ What differences are being referred to here? Differences in degradation between stimulated Pt versus stimulated IrOx electrodes? Or between stimulated Pt and unstimulated PT electrodes? Stimulated IrOx and unstimulated IrOx? Or something else?

      Thank you for your questions. We are comparing platinum against iridium oxide in this sentence. The wording of our original text has been updated to clarify our intention.

      (14) Supplementary Tables: P-values lower than .05, .01, and .001 should simply be replaced with ¡.05, ¡.01, and ¡.001. The alpha value after a Bonferroni correction should be stated somewhere in each table or table caption.

      Thank you for this recommendation. We have edited the tables to reflect this note.

      (15) Title: ‘Material Damage to Multielectrode Arrays after Electrolytic Lesioning is in the Noise’ I don’t understand what the title means. What is in the noise? And what is ‘the noise’?

      “In the noise” is a colloquialism referring to how background information (“noise”) may obscure or distract from other features. This title conveys how material damage to multielectrode arrays due to electrolytic lesioning is largely obscured by the general damage observed on multielectrode arrays after implant and explant.

      (16) This reference has been left out altogether: Chen et al., 2014. The effect of chronic intracortical microstimulation on the electrode-tissue interface.

      Thank you, this reference is now included.

      Reviewer #2 (Recommendations for the authors):

      (1) The number of lesion electrodes is low, especially since there are only 2-10 lesion electrodes on three of the four arrays, yielding limited statistical power.

      We agree that the low number of lesioned electrodes limits statistical power. However, due to ethical considerations, it is unlikely for arrays to contain much more than this number of lesion electrodes.

      (2) The dataset includes both platinum and iridium oxide-coated electrodes. A direct comparison of their damage profiles would be informative.

      Thank you for this recommendation. We have included this additional analysis in Supplementary Materials.

      (3) It is unclear what “is in the Noise” in the title means without reading the manuscript. It is helpful to improve the clarity of the title.

      Thank you for this recommendation.

      (4) Please spell out “PMd” and “M1” at first mention to facilitate reading.

      Thank you for this note. The text has been updated to reflect this recommendation.

    1. eLife Assessment

      This important study presents single-unit activity collected during model-based (MB) and model-free (MF) reinforcement learning in non-human primates. The dataset was carefully collected, and the statistical analyses, including the modeling, are rigorous. The evidence convincingly supports different roles for particular cortical and subcortical areas in representing key variables during reinforcement learning.

    2. Reviewer #1 (Public review):

      Summary:

      Using single-unit recording in 4 regions of non-human primate brains, the authors tested whether these regions encode computational variables related to model-based and model-free reinforcement learning strategies. While some of the variables seem to be encoded by all regions, there is clear evidence for stronger encoding of model-based information in anterior cingulate cortex and caudate.

      Strengths:

      The analyses are thorough, the writing is clear, the work is well-motivated by prior theory and empirical studies.

      Weaknesses:

      The authors have adequately addressed my prior comments.

    3. Reviewer #2 (Public review):

      Summary:

      The authors investigate single-neuron activity in rhesus macaques during model-based (MB) and model-free (MF) reinforcement learning (RL). Using a well-established two-step choice task, they analyze neural correlates of MB and MF learning across four brain regions: the anterior cingulate cortex (ACC), dorsolateral PFC (DLPFC), caudate, and putamen. The study provides strong evidence that these regions encode distinct RL-related signals, with ACC playing a dominant role in MB learning and caudate updating value representations after rare transitions. The authors apply rigorous statistical analyses to characterize neural encoding at both population and single-neuron levels.

      Strengths:

      (1) The research fills a gap in the literature, which has been limited in directly dissociating MB vs. MF learning at the single unit level and across brain areas known to be involved in reinforcement learning. This study advances our understanding of how different brain regions are involved in RL computations.

      (2) The study used a two-step choice task Miranda et al., (2020), which was previously established for distinguishing MB and MF reinforcement learning strategies.

      (3) The use of multiple brain regions (ACC, DLPFC, caudate, and putamen) in the study enabled comparisons across cortical and subcortical structures.

      (4) The study used multiple GLMs, population-level encoding analyses, and decoding approaches. With each analysis, they conducted the appropriate controls for multiple comparisons and described their methods clearly.

      (5) They implemented control regressors to account for neural drift and temporal autocorrelation.

      (6) The authors showed evidence for three main findings:

      (a) ACC as the strongest encoder of MB variables from the four areas, which emphasizes its role in tracking transition structures and reward-based learning. The ACC also showed sustained representation of feedback that went into the next trial.

      (b) ACC was the only area to represent both MB and MF value representations.

      (c) The caudate selectively updates value representations when rare transitions occur, supporting its role in MB updating.

      (7) The findings support the idea that MB and MF reinforcement learning operate in parallel rather than strictly competing.

      (8) The paper also discusses how MB computations could be an extension of sophisticated MF strategies.

      Weaknesses:

      (1) There is limited evidence for a causal relationship between neural activity and behavior. The authors cite previous lesion studies, but causality between neural encoding in ACC, caudate, and putamen and behavioral reliance on MB or MF learning is not established.

      (2) There is a heavy emphasis on ACC versus other areas, but is unclear how much of this signal drives behavior relative to the caudate.

      (3) The authors mention the monkeys were overtrained before recording, which might have led to a bias in MB versus MF strategy.

      (4) The authors have responded to the weaknesses appropriately in the manuscript.

    4. Author response:

      The following is the authors’ response to the original reviews.

      Public Reviews:

      Reviewer #1 (Public review):

      Summary:

      Using single-unit recording in 4 regions of non-human primate brains, the authors tested whether these regions encode computational variables related to model-based and model-free reinforcement learning strategies. While some of the variables seem to be encoded by all regions, there is clear evidence for stronger encoding of model-based information in the anterior cingulate cortex and caudate.

      Strengths:

      The analyses are thorough, the writing is clear, and the work is well-motivated by prior theory and empirical studies.

      Weaknesses:

      My comments here are quite minor.

      The correlation between transition and reward coefficients is interesting, but I'm a little worried that this might be an artifact. I suspect that reward probability is higher after common transitions, due to the fact that animals are choosing actions they think will lead to higher reward. This suggests that the coefficients might be inevitably correlated by virtue of the task design and the fact that all regions are sensitive to reward. Can the authors rule out this possibility (e.g., by simulation)?

      We fully agree with the reviewer that the task design has in-built correlations between transition and reward, and thus the correlation between neural selectivity for feedback and transition (Figure 3E) may be due to the different reward expectation after common or rare transitions. We did try to make this point in the manuscript:

      This suggests that the brain treats being diverted away from your current objective equivalent to losing reward, which is sensible as the subject would normally expect lower rewards on rare trials if their reward-seeking behaviour was efficient.

      We’ve now updated the wording of this statement to try and better make this point and avoid confusion that any non-reward-related encoding is involved:

      “As the reward expectation will be higher on common compared to rare trials, this demonstrates that the brain encodes being diverted to an area with a lower reward expectation equivalent to actually receiving a low reward (and vice versa).”

      We have also adjusted the significance test of this correlation to use a circular permutation test that accounts for correlations between the regressors. This test still found there to be significant correlation in all areas.

      We have described this new permutation test in Methods:

      “For comparing correlations between weights for different features (i.e., between transition and reward coding, Figure 3E), the null distribution of correlations observed in circularly shifted data was compared to the correlation seen in the actual data. This accounts for any correlations between features that existed in the task by preserving the structure of the design matrices.”

      And updated the text in Results accordingly:

      “All regions, but particularly ACC, encoded a common transition (at the time of transition) similar to a high reward (at the time of feedback), as there was a positive correlation between the coefficients for reward and transition (the transition parameter was signed such that common and rare transitions were equivalent to high and low rewards, respectively) (ACC r=0.4963, DLPFC r=0.3273, caudate r=0.4712, putamen, r=0.5052; all p<0.002 except DLPFC where p=0.006, circular permutation test; Figure 3E, S5).”

      The explore/exploit section seems somewhat randomly tacked on. Is this really relevant? If yes, then I think it needs to be integrated more coherently.

      We thank the reviewer for this comment. We agree that the motivation for the explore/exploit analysis was not sufficiently clear in the original version.

      Our aim was not to introduce this as a separate or tangential effect, but rather to highlight how the task’s reward structure (with outcome levels stable for 5–9 trials) naturally created alternating periods favoring exploitation of a known high-value option versus exploration when outcomes changed. This feature of the task is tightly linked to MB-RL computations, as it requires integration of state-transition knowledge and updating across trials.

      Importantly, we show previously in the manuscript that ACC encoded state-transition structure (i.e., common versus rare transition) and MB-value estimates (at choice epoch). However, here we aimed to highlight that the same region also modulated choice encoding as a function of whether the subject was in an exploratory or exploitative regime – by knowing another feature of the task that relies on state-transition and outcome. We have revised this section to better integrate it into the main logic of the paper:

      “In our task, the outcome level (high, medium, low) of each second-stage stimulus remained the same for 5-9 trials before potentially changing. This design naturally created periods where subjects could ‘exploit’ the same Choice 1 to maximize reward for several trials; and other periods where they had to ‘explore’ different second-stage stimuli to optimize reward (as contingencies shifted). In classical MB-RL, the transition between reward states can be learned by keeping counts of observed transitions from a current state-action pair to a subsequent state, yielding a maximum-likelihood estimate of the environment’s dynamics [42]. In fact, knowledge about the reward contingency schedule could support decision-making in both exploitation – by enabling efficient choice when rewards are stable; and exploration – by guiding alternative behaviour most likely to yield improved outcomes (this is different from MF learning, where exploration is more random since the agent lacks explicit state-transition knowledge).

      We thus repeated our decoding analysis of choice 1 stimulus identity, but this time limited trials to those where they had not received a high reward for the previous two trials (‘explore’ trials), and those where the previous two rewards had been the highest level (‘exploit’ trials). All regions encoded choice 1 for some duration of the choice epoch for both explore (p<0.002 in all cases, permutation test; Figure 7A) and exploit (p<0.002 in all cases; Figure 7B) conditions, but decoding accuracy was strongest in ACC. Choice 1 was less strongly decoded – particularly in ACC – in the former condition compared to the latter (p<0.002 for at least 140 ms in all cases, permutation test on differences observed; Figure 7C); and, also during exploitation, the ACC encoded choice 1 before the choice was even presented to the subject (Figure S8). This pre-choice ACC encoding in exploit trials may reflect the need to allocate cognitive (or attentive) resources to features – i.e., choice 1 stimulus identity – that are most certain predictors of important outcomes. As a control, we also decoded the direction of the Choice 1 (where choice was indicated via joystick movement), which was randomised each trial and therefore orthogonal to the stimulus that was chosen. Again, all four regions encoded its direction in both explore (p<0.002 in all cases; Figure 7D) and exploit (p<0.002 in all cases; Figure 7E). However, there were minimal differences in the strength of the representation between explore and exploit conditions (ACC, p=0.088, cluster-based permutation test; DLPFC p=0.016; caudate p=0.32; putamen p=1; Figure 7F). Therefore, exploit behaviour specifically upregulated relevant task parameters that were worth remembering across trials.”

      Reviewer #2 (Public review):

      Summary:

      The authors investigate single-neuron activity in rhesus macaques during model-based (MB) and model-free (MF) reinforcement learning (RL). Using a well-established two-step choice task, they analyze neural correlates of MB and MF learning across four brain regions: the anterior cingulate cortex (ACC), dorsolateral PFC (DLPFC), caudate, and putamen. The study provides strong evidence that these regions encode distinct RL-related signals, with ACC playing a dominant role in MB learning and caudate updating value representations after rare transitions. The authors apply rigorous statistical analyses to characterize neural encoding at both population and single-neuron levels.

      Strengths:

      (1) The research fills a gap in the literature, which has been limited in directly dissociating MB vs. MF learning at the single unit level and across brain areas known to be involved in reinforcement learning. This study advances our understanding of how different brain regions are involved in RL computations.

      (2) The study used a two-step choice task Miranda et al., (2020), which was previously established for distinguishing MB and MF reinforcement learning strategies.

      (3) The use of multiple brain regions (ACC, DLPFC, caudate, and putamen) in the study enabled comparisons across cortical and subcortical structures.

      (4) The study used multiple GLMs, population-level encoding analyses, and decoding approaches. With each analysis, they conducted the appropriate controls for multiple comparisons and described their methods clearly.

      (5) They implemented control regressors to account for neural drift and temporal autocorrelation.

      (6) The authors showed evidence for three main findings:

      (a) ACC as the strongest encoder of MB variables from the four areas, which emphasizes its role in tracking transition structures and reward-based learning. The ACC also showed sustained representation of feedback that went into the next trial. b) ACC was the only area to represent both MB and MF value representations.

      (c) The caudate selectively updates value representations when rare transitions occur, supporting its role in MB updating.

      (7) The findings support the idea that MB and MF reinforcement learning operate in parallel rather than strictly competing.

      (8) The paper also discusses how MB computations could be an extension of sophisticated MF strategies.

      Weaknesses:

      (1) There is limited evidence for a causal relationship between neural activity and behavior. The authors cite previous lesion studies, but causality between neural encoding in ACC, caudate, and putamen and behavioral reliance on MB or MF learning is not established.

      We agree with the reviewer that the present study does not establish causal relationships, and we do not claim otherwise in the manuscript. Our work was designed as a comprehensive characterization of neural activity across ACC, DLPFC, caudate, and putamen during reward-seeking decision-making. By systematically comparing MB- and MF- RL signals across these regions, we provide new insights into the division of labor and cooperative interactions within cortico-striatal networks.

      While causal manipulations (e.g., lesions, inactivations, stimulation) are indeed required to directly establish necessity or sufficiency, correlational studies such as ours play a crucial role in identifying where and how computationally relevant signals are represented. Importantly, our findings align with and extend prior causal work, for example showing that ACC and striatal lesions disrupt MB control. Thus, our study contributes a detailed functional mapping of MB and MF RL encoding across multiple nodes of this circuit, which serves as an important foundation for future causal investigations (e.g., using transcranial ultrasound stimulation).

      (2) There is a heavy emphasis on ACC versus other areas, but it is unclear how much of this signal drives behavior relative to the caudate.

      We appreciate the reviewer's observation regarding this matter. Our intention was not to place a heavy emphasis on ACC, rather this came naturally from the data. The ACC demonstrated considerably more robust and enduring neural activity compared to other brain regions – for instance, reward-related signals in the ACC continued well beyond individual trials (Fig. 2A-B), and encoding of state transitions remained active from the initial transition through to the feedback phase (Fig. 3A-B). By comparison, distinctions among other regions were less pronounced, which naturally resulted in the ACC receiving greater attention in our analytical findings.

      We acknowledge that the caudate plays an essential and complementary role in driving behavior, and we believe that this is emphasized in the two key subsections of our “Results”. First, caudate neurons encoded model-based choice values (Fig. 4A, 4C) and uniquely remapped these values following rare transitions (Fig. 5), reflecting flexible adjustment of action values. Second, decoding analyses showed that both ACC and caudate populations predicted first-stage choices (Fig. 6C), linking their activity directly to behavioral decisions. In the Discussion section, we also highlight that “the distinctive caudate signal of updating (flipping) the value estimates of the currently experienced option on rare trials” goes beyond a “general temporal-difference RPE” and rather supports “the role of caudate in MB valuation”.

      (3) The role of the putamen is somewhat underexplored here.

      Our analyses were conducted in an identical manner across all four recorded regions (ACC, DLPFC, caudate, and putamen), and we consistently reported the results for putamen alongside the others. For example, in the Results section we describe how “both caudate and putamen encoded the reward from the previous trial negatively during the feedback period of the current trial” (Fig. 2F-G), and that “all regions had a significant population of neurons that encoded MB-, but not MF-, derived value” including putamen (Fig. 4F). Similarly, we show that putamen, like caudate, encoded a dopamine-like RPE signal at feedback (“both caudate and putamen neurons clearly responded at feedback with the parametric features of a dopamine-like RPE”; Discussion). These findings align with previous work linking the putamen to MF learning and are discussed explicitly in the context of MF-MB dissociations. We therefore believe that the putamen was not underexplored, but rather that its contribution was more circumscribed relative to ACC and caudate because the signals observed were quantitatively weaker and less distinctive for MB computations.

      (4) The authors mention the monkeys were overtrained before recording, which might have led to a bias in the MB versus MF strategy.

      We agree that extensive training can influence the balance between MB and MF in choice behaviour and neuronal responses.

      In a previous comprehensive behavioral analysis of the same dataset (Miranda et al., 2020, PLoS Computational Biology - ref. 36, Figure S6B) we showed that both MB and MF strategies contributed to behavior, with MB dominance stable across weeks of testing – supporting that overtraining did not eliminate MF influences (but rather stabilized a mixed strategy with robust MB contributions).

      In the same manuscript, we have also: i) cautioned the readers when comparing our results to data from the original human studies; ii) acknowledged that our extensive training cannot address earlier phases of learning in which sensitivity to the task structure is first acquired; and iii) also provided task-related reasons for such MB dominance – as training made the transition structure well learned (making MB computationally less costly and faster to implement) and the non-stationary outcomes favored the flexibility of MB strategies.

      In the present manuscript, we also have acknowledged that overtraining may have shifted neural signals toward stronger MB representations, or alternatively enabled more sophisticated task representations:

      “On the other hand, MF-based estimates were neither as striking nor as specific to striatal regions as expected and observed in previous studies [18]. The monkeys were extensively trained on the task before recordings commenced, which may have caused a shift towards both MB behaviour and MB value representation within the striatum. Alternatively, this training may have allowed more sophisticated representations to occur, such as using latent states to expand the task space [54].”

      Importantly, we strongly believe that this possibility does not detract from our main finding that both MB and MF signals were present across regions, with ACC showing the strongest multiplexing of the two.

      (5) The GLM3 model combines MB and MF value estimates but does not clearly mention how hyperparameters were optimized to prevent overfitting. While the hybrid model explains behavior well, it does not clarify whether MB/MF weighting changes dynamically over time.

      We appreciate this comment and would like to note that, for completeness, we have on several occasions directed the reader to our prior behavioural analysis of the same dataset (Miranda et al., 2020, PLoS Computational Biology, ref 36). In that work, we provide a full and detailed description of both the task and the computational modeling approach (see particularly the “Model fitting procedures” section). Furthermore, our model-fitting was grounded in the MF/MB RL framework used in the original human two-step study (Daw et al., 2011); and the fitting procedures also followed previous studies (Huys et al., 2011).

      Hyperparameters – including the MB/MF weighting parameter (ω) - were estimated using maximum likelihood under two complementary approaches and with priors providing regularization across sessions. First, we performed a fixed-effects analysis, in which parameters were estimated independently for each session by maximizing the likelihood separately; secondly, we conducted a mixed-effects analysis, treating parameters as random effects across sessions within each subject. The effect of the prior procedure reduces the risk of overfitting by constraining parameters based on their empirical distributions, rather than allowing unconstrained session-by-session estimates. Finally, all model fitting procedures were verified on surrogate generated data.

      With regard to dynamic weighting, our approach – consistent with most two-step studies – assumed ω to be constant across trials within each session. This was a deliberate choice, both for comparability with prior work and because our subjects were extensively trained, making session-level stability of strategy weights a reasonable assumption. Indeed, our analyses showed no systematic drift in ω across sessions, suggesting that MB/MF balance was stable over sessions. While approaches that allow dynamic ω estimation are possible, we believe such extensions would likely have minimal impact in the current dataset.

      (6) It was unclear from the task description whether the images used changed periodically or how the transition effect (e.g., in Figure 3) could be disambiguated from a visual response to the pair of cues.

      All images were kept constant across sessions. Common/Rare transitions themselves were not explicitly cued, but rather each second-stage state was associated with a specific background colour, followed ~1s later by the presentation of two specific second-stage choice cues (Figure 1B). Hence the subject could infer whether they were transitioned down a Rare or Common path by the background colour, which can be disambiguated in time from the visual responses to the second-stage cues. We’ve updated the Results text to make this clearer:

      “Tracking the state-transition structure of the task is imperative for solving the task as a MB-learner. All four regions encoded whether the current trial’s first-stage choice transitioned to the common or rare second-stage state (which could be inferred by a change in background colour immediately after choice indicating which second stage state they had just entered, Figure 1A).”

      Recommendations for the authors:

      Reviewer #1 (Recommendations for the authors):

      (1) Figure 7 appears to be missing.

      We thank the reviewer for pointing this out. Figure 7 was inadvertently omitted in the previous version and has now been included in the revised manuscript.

      (2) No stats reported in the section on explore/exploit.

      We apologise for this oversight. This section now also reports the relevant statistics:

      “We thus repeated our decoding analysis of choice 1 stimulus identity, but this time limited trials to those where they had not received a high reward for the previous two trials (‘explore’ trials), and those where the previous two rewards had been the highest level (‘exploit’ trials). All regions encoded choice 1 for some duration of the choice epoch for both explore (p<0.002 in all cases, permutation test; Figure 7A) and exploit (p<0.002 in all cases; Figure 7B) conditions, but decoding accuracy was strongest in ACC. Choice 1 was less strongly decoded – particularly in ACC – in the former condition compared to the latter (p<0.002 for at least 140 ms in all cases, permutation test on differences observed; Figure 7C); and, also during exploitation, the ACC encoded choice 1 before the choice was even presented to the subject (Figure S8). This pre-choice ACC encoding in exploit trials may reflect the need to allocate cognitive (or attentive) resources to features – i.e., choice 1 stimulus identity – that are most certain predictors of important outcomes. As a control, we also decoded the direction of the Choice 1 (where choice was indicated via joystick movement), which was randomised each trial and therefore orthogonal to the stimulus that was chosen. Again, all four regions encoded its direction in both explore (p<0.002 in all cases; Figure 7D) and exploit (p<0.002 in all cases; Figure 7E). However, there were minimal differences in the strength of the representation between explore and exploit conditions (ACC, p=0.088, cluster-based permutation test; DLPFC p=0.016; caudate p=0.32; putamen p=1; Figure 7F).”

      (3) Make sure that error bars are explained in all figure captions where appropriate.

      We apologise that this information was absent. Error bars always represent the standard error of the mean. This has now been added to all relevant figure legends.

      Reviewer #2 (Recommendations for the authors):

      Overall, I think this is a great manuscript and was presented clearly and succinctly. I have some minor suggestions:

      (1) Typo: Abstract "ACC, DLPFC, caudate and striatum" I think should be "caudate and putamen".

      We have amended this incorrect reference in the introduction:

      “One such task that does enable the dissociation of MB and MF computations is Daw et al. (2011)’s ‘two-step’ task [18]. It contains a probabilistic transition between task states to uncouple MF learners (who would assign credit to which state was rewarded regardless of the transition) from MB learners (who would appropriately assign credit based on the reward and transition that occurred). Rodents [19], monkeys [36], and humans [18] all use MB-like behaviour to solve the task. Evidence in rodents suggests dorsal anterior cingulate cortex (ACC) tracks rewards, states, and the probabilistic transition structure, and that ACC is essential in implementing a MB-strategy [37]. Here, we compare primate single neuron activity of 4 different subregions implicated in reward-based learning and choice (ACC, dorsolateral PFC (DLPFC), caudate, and putamen) during performance of the classic two-step task, and demonstrate signatures of MB-RL primarily in ACC, and MF-RL signatures most notably in putamen.”

      (2) Could the authors provide a rationale for why they did the single-level encoding the way they did, instead of running an ANOVA?

      We thank the reviewer for this point. We are not entirely certain which specific ANOVA approach is being suggested, but our rationale for using a GLM-based encoding analysis is that such approach allows us to model continuous, trial-by-trial variables (e.g., value signals, prediction errors, transitions) while simultaneously controlling for multiple correlated predictors. This approach is widely used in systems neuroscience (particularly in decision-making research) offering analytical flexibility and comparability with prior approaches.

      (3) How were the 20 iterations for decoding decided? That seems low.

      We do not agree that 20 repetitions of 5-fold cross validation is low. The error bars in panels 6C-E demonstrate what low variance occurred across these 20 repetitions. It is the average of these low variance repetitions against which we performed statistics by performing a permutation test where these 20 repetitions were repeated a further 500 times.

      (4) It was unclear to me how the authors reached the conclusion "Thus, caudate activity appeared to represent the value of the state the subject was currently in." when the state value wasn't computed directly. I don't see how encoding the chosen and unchosen option is the same as the state the animal is in, which should also incorporate where the animal is in a block of trials or session, and the knowledge regarding the chosen and unchosen option.

      We agree with this point and have tempered this statement:

      “Thus, caudate’s encoding of an option’s value also reflected the availability of the option.”

      (5) Figures 1C, D, and E were not legible to me even at 200% zoom.

      We apologise for this oversight. We’ve now updated panels 1C-E to a more readable size:

      (6) There is a Figure 2H in the figure legend, but the panel appears to be missing from Figure 2.

      This text has been removed.

      (7) Figure 2: It would've been nice to see F and G for all areas.

      We have now added this data as additional panels in Figure 2.

      (8) Figure 3: How is the transition disambiguated from a visual response to the set of images?

      This was indicated by the background changing colour to that of the learned second stage state before the actual choices were presented. We’ve updated the Results text to make this clearer:

      “Tracking the state-transition structure of the task is imperative for solving the task as a MB-learner. All four regions encoded whether the current trial’s first-stage choice transitioned to the common or rare second-stage state (which was indicated by a change in background colour before the second stage choices were presented, Figure 1A).”

      (9) Figure 4F: Is this collapsed across time points? So neurons that were significant at any time? I'm confused how Figure 4A relates to 4F, as 4A shows much lower percentages of significant neurons.

      Figure 4F counts the total number of neurons that had a significant period of encoding at any timepoint over the epoch (as assessed with a length-based permutation test). Whereas, 4A shows the amount of significant encoding neurons at any one time point. Investigating this further, we found that the encoding was dynamic with different neurons encoding different parts of the epoch. We have now added a new supplementary figure to highlight this and refer to it in Results:

      “Examination of the strongest signal observed, ACC’s encoding of MB Q-values, showed a dynamic pattern with different neurons encoding the signal at different parts of the epoch (Figure S6). When aggregating the number of significant coders throughout the epoch, and examining the specificity of MB versus MF coding, we found that all regions had a significant population of neurons that encoded MB-, but not MF-, derived value (30, 18.72, 23 and 24% of neurons in ACC, DLPFC, caudate and putamen respectively; all p<0.0014 binomial test against 10% (as the strongest response to either of the two options was used); Figure 4F).“

      (10) Data/ code could be made publicly available instead of upon request.

      All data and code to reproduce figures are now available at https://github.com/jamesbutler01/TwoStepExperiment. The manuscript has been updated to reflect this:

      Data and materials availability:

      All data and code to reproduce figures are available at https://github.com/jamesbutler01/TwoStepExperiment.

    1. eLife Assessment

      This valuable study utilizes a newly developed approach to culture T gondii bradyzoites in myotubes, and then takes advantage of the antiparasitic compound collection known as the Pathogen Box, to find compounds that target both tachyzoite and bradyzoite forms of the parasite. A set of compounds yielding patterns consistent with targeting the mitochondrial bc1 complex was explored further, with solid evidence for changes in ATP production in bradyzoites to support the conclusions about the importance of this complex. The paper will be interesting for parasitologists studying drug discovery of apicomplexan parasites.

    2. Reviewer #1 (Public review):

      Summary:

      The authors' goal was to advance the understanding of metabolic flux in the bradyzoite cyst form of the parasite T. gondii, since this is a major form of transmission of this ubiquitous parasite, but very little is understood about cyst metabolism and growth.

      Nonetheless, this is an important advance in understanding and targeting bradyzoite growth.

      Strengths:

      The study used a newly developed technique for growing T. gondii cystic parasites in a human muscle-cell myotube format, which enables culturing and analysis of cysts. This enabled screening of a set of anti-parasitic compounds to identify those that inhibit growth in both vegetative (tachyzoite) forms and bradyzoites (cysts). Three of these compounds were used for comparative Metabolomic profiling to demonstrate differences in metabolism between the two cellular forms.

      One of the compounds yielded a pattern consistent with targeting the mitochondrial bc1 complex, and suggest a role for this complex in metabolism in the bradyzoite form, an important advance in understanding this life stage.

      Weaknesses:

      Studies such as these provide important insights into the overall metabolic differences between different life stages, and they also underscore the challenge with interpreting individual patterns caused by metabolic inhibitors due to the systemic level of some of some targets, so that some observed effects are indirect consequences of the inhibitor action. While the authors make a compelling argument for focusing on the role of the bc1 complex, there are some inconsistencies in the some patterns that underscore the complexity of metabolic systems.

    3. Reviewer #2 (Public review):

      Summary:

      A particular challenge in treating infections caused by the parasite Toxoplasma gondii is to target (and ultimately clear) the tissue cysts that persist for the lifetime of an infected individual. The study by Maus and colleagues leverages the development of a powerful in vitro culture system for the cyst-forming bradyzoite stage of Toxoplasma parasites to screen a compound library for candidate inhibitors of parasite proliferation and survival. They identify numerous inhibitors capable of inhibiting both the disease-causing tachyzoite and the cyst-forming bradyzoite stages of the parasite. To characterize the potential targets of some of these inhibitors, they undertake metabolomic analyses. The metabolic signatures from these analyses lead them to identify one compound (MMV1028806) that interferes with aspects of parasite mitochondrial metabolism. In the revised version of the manuscript, the authors present convincing evidence that MMV1028806 targets the mitochondrial electron transport (ETC) chain of the parasite (although they don't identify the actual target in the ETC). The revised manuscript also nicely addresses my other criticisms of the original version. Overall, the study presents an exciting approach for identifying and characterizing much-needed inhibitors for targeting tissue cysts in these parasites.

      Strengths:

      The study presents convincing proof-of-principle evidence that the myotube-based in vitro culture system for T. gondii bradyzoites can be used to screen compound libraries, enabling the identification of compounds that target the proliferation and/or survival of this stage of the parasite. The study also utilizes metabolomic approaches to characterize metabolic 'signatures' that provide clues to the potential targets of candidate inhibitors. In addition to insights into candidate bradyzoite inhibitors, the study also provides new insights into the physiological role of the mitochondrial electron transport chain of bradyzoites, and raises a host of interesting questions around the functional roles of mitochondria in this stage of the parasite.

      Weaknesses:

      In the revised manuscript, the authors have included additional oxygen consumption rate data that indicate that MMV1028806 targets the mitochondrial electron transport chain (ETC). These data are convincing. On line 481, the authors state that "treatments with ATQ, BPQ, MMV1028806, and antimycin A resulted in substantially reduced oxygen consumption levels relative to the DMSO control and suggest indeed a blockage of the mETC consistent with the inhibition of the bc1-complex." The OCR assay the authors use is still only an indirect measure of bc1 activity. Given that most OCR-inhibiting compounds in T. gondii are bc1 inhibitors, it is possible (and perhaps likely) that MMV1028806 is targeting this complex. However, the data cannot rule out that it is targeting another component of the ETC (or potentially even a TCA cycle enzyme). Without a direct test that MMV1028806 inhibits bc1 complex activity, the authors should be more cautious in their interpretation (e.g. by acknowledging the limitations of their conclusion, or acknowledging other possible targets). Similarly, the conclusion on line Line 622 that "... we confirmed the bc1-complex as a target" is overstating the findings. The phrasing on lines 683-695 is more appropriate: "... suggesting that it also targets complex III or a functionally linked site within the mitochondrial electron transport chain."

    4. Reviewer #3 (Public review):

      Summary:

      The authors described an exciting 400-drug screening using a MMV pathogen box to select compounds that effectively affect the medically important Toxoplasma parasite bradyzoite stage. This work utilises a bradyzoites culture technique that was published recently by the same group. They focused on compounds that affected directly the mitochondria electron transport chain (mETC) bc1-complex and compared with other bc1 inhibitors described in the literature such as atovaquone and HDQs. They further provide metabolomics analysis of inhibited parasites which serves to provide support for the target and to characterise the outcome of the different inhibitors.

      Strengths:

      This work is important as, until now, there are no effective drugs that clear cysts during T. gondii infection. So, the discovery of new inhibitors that are effective against this parasite-stage in culture and thus have the potential to battle chronic infection is needed. The further metabolic characterization provides indirect target validation and highlight different metabolic outcome for different inhibitors. The latter forms the basis for new studies in the field to understand the mode of inhibition and mechanism of bc1-complex function in detail.

      The authors focused in the function of one compound, MMV1028806, that is demonstrated to have a similar metabolic outcome to burvaquone. Furthermore, the authors evaluated the importance of ATP production in tachyzoite and bradyzoites stages and under atovaquone/HDQs drugs.

    5. Author response:

      The following is the authors’ response to the original reviews.

      Public Reviews:

      Reviewer #1 (Public review):

      Summary:

      The authors' goal was to advance the understanding of metabolic flux in the bradyzoite cyst form of the parasite T. gondii, since this is a major form of transmission of this ubiquitous parasite, but very little is understood about cyst metabolism and growth. Nonetheless, this is an important advance in understanding and targeting bradyzoite growth.

      Strengths:

      The study used a newly developed technique for growing T. gondii cystic parasites in a human muscle-cell myotube format, which enables culturing and analysis of cysts. This enabled the screening of a set of anti-parasitic compounds to identify those that inhibit growth in both vegetative (tachyzoite) forms and bradyzoites (cysts). Three of these compounds were used for comparative Metabolomic profiling to demonstrate differences in metabolism between the two cellular forms.

      One of the compounds yielded a pattern consistent with targeting the mitochondrial bc1 complex and suggests a role for this complex in metabolism in the bradyzoite form, an important advance in understanding this life stage.

      Weaknesses:

      Studies such as these provide important insights into the overall metabolic differences between different life stages, and they also underscore the challenge of interpreting individual patterns caused by metabolic inhibitors due to the systemic level of some of the targets, so that some observed effects are indirect consequences of the inhibitor action. While the authors make a compelling argument for focusing on the role of the bc1 complex, there are some inconsistencies in the patterns that underscore the complexity of metabolic systems.

      We agree with reviewer #1 that metabolic fingerprints are complex to interpret and we did try to approach this problem by including mock treatment and non-metabolic inhibitors as controls. We address specific concerns below.

      Reviewer #2 ( Public review):

      Summary:

      A particular challenge in treating infections caused by the parasite Toxoplasma gondii is to target (and ultimately clear) the tissue cysts that persist for the lifetime of an infected individual. The study by Maus and colleagues leverages the development of a powerful in vitro culture system for the cyst-forming bradyzoite stage of Toxoplasma parasites to screen a compound library for candidate inhibitors of parasite proliferation and survival. They identify numerous inhibitors capable of inhibiting both the disease-causing tachyzoite and the cyst-forming bradyzoite stages of the parasite. To characterize the potential targets of some of these inhibitors, they undertake metabolomic analyses. The metabolic signatures from these analyses lead them to identify one compound (MMV1028806) that interferes with aspects of parasite mitochondrial metabolism. The authors claim that MV1028806 targets the bc1 complex of the mitochondrial electron transport chain of the parasite, although the evidence for this is indirect and speculative. Nevertheless, the study presents an exciting approach for identifying and characterizing much-needed inhibitors for targeting tissue cysts in these parasites.

      Strengths:

      The study presents convincing proof-of-principle evidence that the myotube-based in vitro culture system for T. gondii bradyzoites can be used to screen compound libraries, enabling the identification of compounds that target the proliferation and/or survival of this stage of the parasite. The study also utilizes metabolomic approaches to characterize metabolic 'signatures' that provide clues to the potential targets of candidate inhibitors, although falls short of identifying the actual targets.

      Weaknesses:

      (1) The authors claim to have identified a compound in their screen (MMV1028806) that targets the bc1 complex of the mitochondrial electron transport chain (ETC). The evidence they present for this claim is indirect (metabolomic signatures and changes in mitochondrial membrane potential) and could be explained by the compound targeting other components of the ETC or affecting mitochondrial biology or metabolism in other ways. In order to make the conclusion that MMV1028806 targets the bc1 complex, the authors should test specifically whether MMV1028806 inhibits bc1-complex activity (i.e. in a direct enzymatic assay for bc1 complex activity). Testing the activity of MMV1028806 against other mitochondrial dehydrogenases (e.g. dihydroorotate dehydrogenase) that feed electrons into the ETC might also provide valuable insights. The experiments the authors perform also do not directly measure whether MMV1028806 impairs ETC activity, and the authors could also test whether this compound inhibits mitochondrial O2 consumption (as would be expected for a bc1 inhibitor).

      We thank the reviewer for highlighting this important aspect. To further investigate the effect of MMV1028806 on the mETC, we adapted a commercial oxygen consumption assay and demonstrated that MMV1028806, like Atovaquone and Buparvaquone, inhibits the ETC, leading to reduced oxygen consumption similar to Antimycin A, which inhibits the bc1-complex. These results are now included in the revised manuscript (Methods, lines 210–233; Results, lines 460–468).

      (2) The authors claim that compounds targeting bradyzoites have greater lipophilicity than other compounds in the library (and imply that these compounds also have greater gastrointestinal absorbability and permeability across the blood-brain barrier). While it is an attractive idea that lipophilicity influences drug targeting against bradyzoites, the effect seems pretty small and is complicated by the fact that the comparison is being made to compounds that are not active against parasites. If the authors are correct in their assertion that lipophilicity is a major determinant of bradyzoicidal compounds compared to compounds that target tachyzoites alone, you would expect that compounds that target tachyzoites alone would have lower lipophilicity than those that target bradyzoites. It would therefore make more sense to (statistically) compare the bradyzoicidal and dual-acting compounds to those that are only active in tachyzoites (visually the differences seem small in Figure S2B). This hypothesis would be better tested through a structure-activity relationship study of select compounds (which is beyond the scope of the study). Overall, the evidence the authors present that high lipophilicity is a determinant of bradyzoite targeting is not very convincing, and the authors should present their conclusions in a more cautious manner.

      Thank you for raising this excellent point. We performed a statistical test of tachyzoidal and both bradyzoidal and dually active compounds and find indeed no significant difference (P = 0.06). We altered the results text line 367-368 and the figure S2B caption to explicitly mention this.

      (3) Page 11 and Figure 7. The authors claim that their data indicate that ATP is produced by the mitochondria of bradyzoites "independently of exogenous glucose and HDQ-target enzymes." The authors cite their previous study (Christiansen et al, 2022) as evidence that HDQ can enter bradyzoites, since HDQ causes a decrease in mitochondrial membrane potential. Membrane potential is linked to the synthesis of ATP via oxidative phosphorylation. If HDQ is really causing a depletion of membrane potential, is it surprising that the authors observe no decrease in ATP levels in these parasites? Testing the importance of HDQ-target enzymes using genetic approaches (e.g. gene knockout approaches) would provide better insights than the ATP measurements presented in the manuscript, although would require considerable extra work that may be beyond the scope of the study. Given that the authors' assay can't distinguish between ATP synthesized in the mitochondrion vs glycolysis, they may wish to interpret their data with greater caution.

      We thank the reviewer for addressing this important point. The enzymatic assay used in our study cannot distinguish whether ATP is produced via glycolysis or mitochondrial respiration. However, we minimized glycolytic ATP production in bradyzoites by starving them for one week without glucose. After this period, amylopectin stores are depleted, forcing the parasites to utilize glutamine via the GABA shunt to fuel the TCA cycle and generate ATP predominantly through respiration. While minor ATP production via gluconeogenic fluxes cannot be excluded, the main ATP supply under these conditions is expected to originate from the mitochondrial electron transport chain. Indeed, ATP levels are lower in HDQ-treated bradyzoites, which we attribute to the compound’s impact on electron-supplying enzymes upstream of the bc1 complex, although this inhibition is not sufficient to fully abolish ATP production as observed with Atovaquone treatment.

      Reviewer #3 (Public review):

      Summary:

      The authors describe an exciting 400-drug screening using a MMV pathogen box to select compounds that effectively affect the medically important Toxoplasma parasite bradyzoite stage. This work utilises a bradyzoites culture technique that was published recently by the same group. They focused on compounds that affected directly the mitochondria electron transport chain (mETC) bc1-complex and compared them with other bc1 inhibitors described in the literature such as atovaquone and HDQs. They further provide metabolomics analysis of inhibited parasites which serves to provide support for the target and to characterise the outcome of the different inhibitors.

      Strengths:

      This work is important as, until now, there are no effective drugs that clear cysts during T. gondii infection. So, the discovery of new inhibitors that are effective against this parasite stage in culture and thus have the potential to battle chronic infection is needed. The further metabolic characterization provides indirect target validation and highlights different metabolic outcomes for different inhibitors. The latter forms the basis for new studies in the field to understand the mode of inhibition and mechanism of bc1-complex function in detail.

      The authors focused on the function of one compound, MMV1028806, that is demonstrated to have a similar metabolic outcome to burvaquone. Furthermore, the authors evaluated the importance of ATP production in tachyzoite and bradyzoites stages and under atovaquone/HDQs drugs.

      Weaknesses:

      Although the authors did experiments to identify the metabolomic profile of the compounds and suggested bc-1 complex as the main target of MMV1028806, they did not provide experimental validation for that.

      In our updated manuscript we performed additional experiments such as oxygen consumption assay to further qualify the bc1 complex as the target. We also toned down some of our statements to make sure that no false claims are made.

      Recommendations for the authors:

      Reviewer #1 (Recommendations for the authors):

      Introduction: It would be helpful to briefly describe what the pathogen Box is, what compounds are in it, and the rationale for using a drug screen to better understand mitochondrial function in cysts.

      Thank you for this suggestion, we added an introduction of the MMV pathogen box and outlined our rationale for our experimental approach in lines 90 to 99.

      Please explain why dual-active drugs were useful for understanding differences, rather than just seeking drugs that might target bradyzoites alone.

      We focused on dually active compounds for two reasons. First, these are the most promising and potent targets to develop drugs against. Both stages might occur simultaneously and these dually active drugs may eliminate the need for treatment with a drug combination. Second, we speculated that monitoring the responses to inhibition of the same process in both parasite stages would reveal its functional consequences. Dually active compounds enable this direct comparison. Bradyzoite-specific compounds may be interesting from a developmental perspective but may require a reverse genetic follow-up to compare differences between stages. The lack of a well-established inducible expression system in bradyzoites that allows short term and synchronized knock-down makes metabolomic approaches difficult. We added these two points in brief to the results section (line 378 – 381).

      Figure 4: this is a very important figure in understanding the significance of the work, but it is not well described in the legend. Even if these graphics have been used in other manuscripts, it would be helpful to provide better annotation in the figure legend.

      Thank you for pointing this out. We expanded the figure legend to explain the isotopologues data in more detail. Line 793 to 802.

      B,D: Explain what the three columns for each drug category represent.

      Addressed

      C,E: Explain what isotopologues are, what the M+ notation means, and what the pie charts represent. Other main figures have suitable legends.

      Addressed

      Discussion: there are several places where the reasoning is a bit hard to follow, and rearrangement to provide a clear logical flow would be helpful. In particular, the reasoning for why HDQ impairs active but non-essential processes could be laid out more clearly.

      We added additional clarifications to the discussion section and re-wrote the HDQ paragraph. We hope that our reasoning is now easier to follow.

      Abbreviations: A list of abbreviations for the entire manuscript would be helpful.

      This is a good idea and we now provide an abbreviations list.

      Minor typos:

      P12, 2d paragraph: sentence beginning with: Consistent with this hypothesis... "cysts" is used twice

      Corrected

      P15, top of the second paragraph: "nano" and "molar" should be one word

      Corrected

      Reviewer #2 (Recommendations for the authors):

      Major comments (not already covered in the weaknesses section of the public review)

      (1) Figure 2 and the related description of these experiments in the methods section (page 3). The approach for calculating IC50 values for the compounds against tachyzoites is unclear. How did the authors determine the time point for calculating IC50 vacuoles? Was this when the DMSO control wells reached maximum fluorescence? This could be described in a clearer manner. A concern with calculating IC50 values on different days is that parasites will have undergone more lytic cycles after 7 days compared to 4 days, which means that the IC50 values for fast- vs slow-acting compounds might be quite different between these days. As a more minor comment on these experiments, the methods section does not describe whether the test compound was removed after 7 days, as the experimental scheme in Figure S1A seems to imply. Please clarify in the methods section.

      This is a very good point and we clarified this in the methods section, line 157–160. In brief, we choose the latest time point when exponential growth could be observed in the fastest growing cultures, generally this was in mock treated cultures and at day 4 post infection. We also clarified that we changed media and removed treatment after 7 days.

      Minor Comments

      (2) Page 2. "we employed a recently developed human myotube-based culture system to generate mature T. gondii drug-tolerant bradyzoites". What makes these bradyzoites 'drug-tolerant' or to which drugs are they tolerant? This isn't clear from the description.

      We added these details in the introduction (line 94 to 96) and state that these cysts develop resistance against anti-folates, bumped kinase inhibitors and HDQ, a Co-enzyme Q analog.

      (3) Figure 1E. The number of compounds in this pie chart adds up to 384, whereas the methods describe that 371 compounds were tested. What explains this discrepancy in numbers?

      We understand the confusion. We now updated the pie chart to reflect only compounds that were included in the primary screen (371) as reflected in Supplementary Table S1. We separately analysed 29 compounds that were previously tested against tachyzoites by Spalenka et al., and found an additional 13 compound, that were originally included in the pie chart. In a secondary test the activity of 10 of these 13 compounds could be confirmed. All in all we found the 16 compounds shown in Fig. 2 E-G.

      (4) Page 3. The resazurin assays for measuring host cell viability could be explained in a clearer manner. What host cells were used? Were the host cells confluent when the drug was added (and the assay conducted) or was the drug added when the host cells were first seeded? How long were the host cells cultured in the candidate inhibitors before the assays were performed? What concentration (or concentration range) were the compounds tested? The host inhibition data are not easily accessible to the reader - the authors might consider including these data as part of Table S2D.

      The necessary information was added to the methods section (line 145 to 153). We tested for host toxicity in both HFF and KD3 myotubes during the primary screen at 10 µM in triplicates. The colorimetric assay was performed after tachyzoite growth assays in HFFs 7 days post infection and after completion of the 4 week re-growth phase of bradyzoites in myotubes. The resulting data is already part of Supplementary File 1. In addition, we performed concentration dependent resazurin assays after secondary concentration dependent growth inhibition assays and also included data in Supplementary File 1. For the bradyzoite growth assay we performed visual inspection after drug exposure for one week and before tachyzoite re-growth to detect missing or damaged monolayer. Also, this data is included in the Supplementary File 1. We also included the cytotoxicity data as suggested into Table S2D.

      (5) Page 7. "Except for four compounds (MMV021013, MMV022478, MMV658988, MMV659004), minimal lethal concentrations were higher in bradyzoites". The variation in these data seems quite large to be making this claim. Consider a statistical analysis of these data to compare potencies in tachyzoites vs bradyzoites.

      With this sentence we aimed to describe the results and not to make a statement. We toned down the sentence to “… minimal lethal concentrations appear generally higher in bradyzoites… “ line 344 to 347. We also added a line 1 µM in the charts to facilitate easier comparison of compound efficacies.

      (6) It would be helpful to readers to include the structures of hit compounds in the figures (perhaps as part of Figure 3).

      This is a good idea and would improve the manuscript. To not overburden figure 3 we added structures to Fig S3.

      (7) Page 8. "Infected monolayers were treated for three hours with a 3-fold of respective IC50 concentrations". 3-fold higher than IC50 concentrations? This isn't clear.

      Thank you for noticing this: We clarified the sentence and also corrected the concentration, corresponding to five times their IC50s as stated in the methods section: “Infected monolayers were treated for three hours with compound concentrations five times their respective IC<sub>50</sub> values or the solvent DMSO.” Line 374 - 376

      (8) Page 9. "buparvaquone, which we found to be dually active against T. gondii tachyzoites and bradyzoites, targets the bc1-complex in Theileria annulata (McHardy et al. 1985) and Neospora caninum (Müller et al. 2015) and was recently found active against T. gondii tachyzoites (Hayward et al. 2023)." The latter paper showed that buparvaquone targets the bc1 complex in T. gondii tachyzoites as well.

      Yes, it was found to inhibit O2 consumption rate in tachyzoites. We changed the sentence accordingly. Line 407 to 411.

      (9) Page 9. "Anaplerotic substrates were also affected by all three treatments, most notably a strong accumulation of aspartic acid." It is interesting that the M+3 isotopologue of aspartate (presumably synthesised from pyruvate) is the predominant form (rather than the M+2 and M+4 isotopologues that would derive from the TCA cycle, and as the diagram in Figure 4A seems to suggest). Given that aspartate is a precursor of pyrimidine biosynthesis that is upstream of the DHODH reaction, it is conceivable that its accumulation is related to the depletion of pyrimidine biosynthesis (so would tie into the point about the accumulation of DHO and CarbAsp noted earlier in the paragraph).

      Yes, we assume the same. We altered the text and summarized the changes in Asp as a result of DHOD inhibition, as we also already do in the next paragraph using <sup>15</sup>N-glutamine labelling. Line: 416 - 418

      (10) Figure 6 and Page 10. Regarding the metabolomic experiments that show increased levels of acyl-carnitines. The authors note that "Since [beta-oxidation] is thought to be absent in T. gondii, we attribute these changes to inhibition of host mitochondria". This is conceivable, although the T. gondii genome does encode homologs of the proteins necessary for beta-oxidation (e.g. see PMID 35298557). If the carnitine is coming from host mitochondria, is host contamination a concern for interpreting the metabolomic data? Or do the authors think that parasites are scavenging carnitine from host cells? It is curious that the carnitine accumulation is observed in parasites treated with buparvaquone (and MMV1028806) but not atovaquone, even though buparvaquone and atovaquone (and possibly MMV1028806) target the same enzyme. Do the authors have any thoughts on why that might be the case?

      Yes, thank you for raising this point. We changed the discussion elaborating on this and included the debated presence of beta-oxidation: line 640: “We also detect elevated levels of acyl-carnitines in BPQ and MMV1028806 treated bradyzoites. These molecules act as shuttles for the mitochondrial import of fatty acids for β-oxidation. However, this pathway has not been shown to be active and is deemed absent in T. gondii (35298557, 18775675). The presence of acyl-carnitines in bradyzoites might reflect import from the host. It is conceivable that their elevation in response to buparvaquone and MMV1028806 indicates compromised functionality of the host bc1-complex and subsequently accumulating β-oxidation substrates. Indeed, BPQ has a very broad activity across Apicomplexa (Hudson et al. 1985) and kinetoplastids (Croft et al. 1992).“ Regarding the existence of beta-oxidation: some potential enzymes might be conserved, but those could in part take part in branched chain amino acid degradation pathways. On a separate note: we looked extensively on beta-oxidation using stable isotope labelling and became convinced that any activity occurred in the host cell only but not in the parasite (unpublished).

      (11) Page 11. "the mitochondrial [electron] transport chain in bradyzoites".

      Corrected.

      (12) Figure S6B. Were these optimization experiments performed in tachyzoites or bradyzoites? If the former, and given that bradyzoites have apparently smaller amounts of ATP per parasite (Figure 7C), are these values in the linear range for 10^5 bradyzoites?

      Yes, we do think that the assay remains linear for these lower concentrations. Tachyzoites give a linear response starting from 10^3 parasites per sample. In the actual experiment we used 10^5 parasites, both tachyzoites and bradyzoites. Under the tested conditions bradyzoites maintain 10% of the ATP pools of tachyzoites, which should be well within the linear range of the assay. Also in Atovaquone-treated bradyzoites ATP concentration could be lower to 10% and still remain in the linear range of the assay. For practical reasons, we simply acknowledge this limitation and consider it acceptable within the scope of this study.

      Reviewer #3 (Recommendations for the authors):

      Major comments

      (1) The authors should provide a negative control for the experiment on Figure 5. I would suggest doing the same experiment with an inhibitor that has no effect on mitochondrial potential.

      We addressed this criticism by repeating the assay on tachyzoites and additionally including inhibitors that do not have the mitochondrial electron transport chain as their primary target (Pyrimethamine, Clindamycin, 6-Diazo-5-oxo-L-norleucin). The results are summarized in the supplementary Fig S5, line 445 – 449) and show that there is no effect of these inhibitors on the mitochondrial membrane potential. This supports the specificity of the assay and suggests that MMV1028806 and BPQ indeed target a mitochondrial process in this stage. Also, in this repetition ATQ, BPQ and MMV1028806 did significantly deplete the Mitotracker signal.

      (2) Figure 5 - Did the authors perform this experiment in 3 biological replicates? This requires clarification of the figure legend.

      No, we did not perform the experiment in 3 biological replicates. After establishing the assay thoroughly, we performed it once on tachyzoites and bradyzoites. The sampling was done on every vacuole we encountered during microscopy going through the slide from left to right. That is the reason the sample size varies from treatment to treatment. The sample size is mentioned in the caption of figure 5. However, we repeated the experiment with additional controls (see Fig. S5), which showed that the Mitotracker signals were significantly depleted in a very similar manner in ATQ, BPQ and MMV1028806 treated parasites.

      (3) The authors identify that MMV1028806 has bc1-complex as the main target. I suggest that they should perform a complex III activity assay to affirm this. Also, it would be good to test if other mETC complexes are affected by this compound to prove its specificity. There is only one paper showing complex III activity in tachyzoites (PMID:37471441) and no papers in bradyzoites. So if the authors cannot do this assay, I suggest that they should change the text indicating that bc-1 complex could be the main target of the compound but more experimental validation is needed.

      We hope to have satisfied the reviewer’s request by performing an oxygen consumption assay on tachyzoites. Together with metabolic profiling and labelling data, this shows that both upstream and downstream processes are impacted by MMV1028806 and strongly suggest the bc1-complex as a target (Fig 5E).

      (4) Figure S5 - Are the differences shown in the EM experiment statistically supported?

      We analyzed 28 images and measured the areas in 12 to 26 images. We substituted the table of means in Fig S6B by a graph showing individual values. These areas are indeed statistically different between DMSO and ATQ / MMV treated parasites. We changed the wording in the results section accordingly “Analysis by thin section electron microscopy revealed a largely unaffected sub-mitochondrial ultrastructure but the areas of mitochondrial profiles were changed in comparison to control after exposure with ATQ and MMV1028806 but not with BPQ (Fig. S6)“. The description of Fig S6B was changed to “(B) Measured areas of mitochondrial profiles from 21, 12, 15 and 26 images showing DMSO, ATQ, BPQ and MMV1028806 treated parasites (* denotes p < 0.05 in Mann-Whitney tests)”.

      Minor comments:

      (1) What was the criteria to choose the example compounds in Figure 1B and 1D? The authors should clarify this in the text.

      These graphs are shown for illustrative purposes and were chosen based on their display of different drug efficacies. We considered this helpful for interpreting the screening data.

      (2) Figure 2G - add statistical analysis.

      We added Mann-Whitney tests and updated the figure legend and results text accordingly in line 344 – 347.

      (3) The authors should provide more insights in the discussion about why this new compound is the next step in drug discovery compared to atovaquone or burvaquone - for example, do you expect better availability in the brain, etc.

      We used MMV1028806 and the other hits ATQ and BPQ to make the point that the bc1-complex is a good target in bradyzoites that allows curative treatment. We do not suggest that the compound itself is a good starting point. We point to other actively developed candidates such as ELQ series in the discussion, line 719.

      (4) Scale bars in Figure 5 should be aligned and have equal thickness.

      We re-formatted the scale bars and aligned them when not obscuring parasites.

      (5) The authors should be consistent with font sizes and styles in all the figures.

      We adjusted the font styles to match each other.

    1. eLife Assessment

      This study provides valuable data regarding gene expression and molecular changes that occur in the mouse spinal cord from exercise and motor activity. Overall, the findings and methods are solid, although additional independent validation experiments would improve the rigor of the study. The work provides resources for neuroscientists who investigate communication between neurons and non-neurons and both basic and translational scientists with interests in how physical activity impacts the nervous system function, with potential therapeutic outcomes.

    2. Reviewer #1 (Public review):

      Summary:

      The authors integrated bulk proteomics, single-nucleus RNA sequencing, and cellular communication pipelines to map molecular changes in the mouse lumbar spinal cord following endurance training versus acute exhaustive exercise. This kind of data is currently missing in the literature for the healthy spinal cord; therefore, this work represents a useful resource for the community for the investigation of cellular mechanisms of exercise-induced neuroplasticity. The authors found that endurance training elicited robust plastic transcriptional changes in the glia, in genes involved in synaptic modulation, axon development, and intercellular signaling, with cell-specific differences. Acute exhaustive exercise triggered a more nuanced biphasic temporal response in metabolic and synaptic genes, which was different in trained versus sedentary mice. Although cholinergic neurons did not show robust gene expression changes, they were found to be central hubs for communication with glia, suggesting that their cues may act as upstream regulators of glial plasticity.

      Strengths:

      Nuclei fixation minimized unwanted RNA degradation and tissue processing-driven expression changes. However, in the text, it needs to be acknowledged that the fixation step was performed only after nuclei isolation, and not at the stage of spinal cord tissue collection. The time course study design allowed for the distinction of different temporal gene expression trajectories.

      Weaknesses:

      No clear indication of the number of biological replicates is given. No validation of the key findings with alternative methods is presented.

      Some aspects of data analysis need to be clarified:

      (1) Methods

      a) Voluntary exercise: the authors should indicate whether the mice were singly housed, and, if not, clarify that the indicated mean km/day is an average of the mice in the cage.

      b) The Authors should indicate more precisely which lumbar level of the spinal cord was used and the number of biological replicates.

      c) The Authors should indicate the number of highly variable features and PCs (dims) used for Seurat and provide a QC metric table.

      (2) Results and Figures

      a) Bulk proteomic analysis: The authors used Pval-and not FDR- to assess differentially abundant proteins. Can the author indicate how many proteins passed a more stringent FDR cutoff? For GO analysis: the authors should indicate what background/reference was used.

      b) Figure 1B and Figure S1B-C: the differences in total mass and relative lean mass are very subtle, even if statistically significant. This needs to be acknowledged in the relevant sentences.

      c) Figure 2 and Figure S2E panels G and H are inverted.

      d) Heatmaps in Figures 1F and 2 Figure 2E-F: some of the proteins and genes listed in the text are not present in the heatmaps (TIM22 and FABP4; Smap25 and Slc4a4). Please check the correspondence of the text with the heatmap, and indicate with an arrow the listed proteins and genes.

      e) Page 9 "trained mice displayed a modest increase of oligodendrocytes 24h": from the plot, it looks to me like a decrease rather than an increase.

      f) Figure 4 depicts expression changes in selected metabolism and synaptic activity-related genes: it would be useful to add a table as a supplementary file with expression data of all the synaptic and metabolic genes in addition to the ones that were selected.

    3. Reviewer #2 (Public review):

      Mansingh et al., investigate the impact of voluntary wheel training and acute physical exercise on the transcriptomic and proteomic profile of spinal cord tissues from young adult mice. They first describe the proteomic and transcriptomic differences between sedentary mice and mice provided with running wheels for voluntary exercise. They show that voluntary physical exercise induces changes at a transcriptional level as well as at a proteomic level, with most of these effects restricted to glial cells. They further analyze the putative cell interactions that are induced in the context of physical training and describe the specificity of transcriptional changes in the different cell populations. Using the same multi-omics pipeline, the authors assess dynamic changes in sedentary and trained mice 6 and 24 hours following a bout of physical exercise until exhaustion. Importantly, they demonstrate that the impact of this single bout to exhaustion is modified in mice that have access to running wheels compared with sedentary mice, with a reduced amplitude of the reaction and a faster resolution of changes caused by exercise until exhaustion.

      Altogether, this study provides a useful description of the transcriptional changes at play following voluntary physical training and, importantly, uncovers the role of this training in shaping future transcriptomic reactions to a stressful bout of exercise until exhaustion. However, the conclusions of the manuscripts would be strengthened by the clarification of the methods, a better use of the proteomic data regarding the transcriptomic datasets, and a cross-validation of the main claims currently based solely on transcriptomic datasets.

      (1) In this study, the housing strategy used is key as it will impact both the proteome and transcriptome of cells in the central nervous system. It can be difficult to measure the running activity of individual mice if they are not housed individually. Yet, individual housing has a major impact on the nervous system and notably on glial cells. Therefore, a better description of the housing strategy for the sedentary and trained group during the 6 weeks of training is required.

      (2) In the first part of the paper that uses the results from the first set of multi-omics data, the protocol used is not clear. From Figure 1A, it seems that the mice went through a max performance test before and after the 6-week period in which the two groups had different life experiences (voluntary running versus sedentary). Since in the methods the maximal test protocol is effectively an exercise until exhaustion, it is difficult to understand why the authors defined this first experiment as the one allowing them to test "molecular remodeling in the spinal cord at rest". Also, it is not clear how long after the max performance test the tissues were collected. If indeed the mice went through the max endurance test before tissue collection, it is not a condition at rest, and this first protocol in some way looks like a duplication of a subpart of the second experiment. If mice did not go through this max performance test, it needs to be clarified both in the text and in the figure.

      (3) One of the strengths of this study is its multi-omics approach assessing changes at both transcriptomic and proteomic levels. Yet, the use by authors of the proteomic datasets is minimal, and there are no comments on how the proteomic and transcriptomic datasets support each other. Changes at the transcriptional level do not necessarily translate into changes at the protein level. Therefore, it would improve the quality of the study if authors could use the bulk proteomic data in relation to the transcriptomic dataset. The fact that the proteomic datasets do not provide the identity of the cells from which the changes originate should not prevent authors from putting them in perspective with transcriptomic results.

      (4) None of the results from the single-nucleus RNA sequencing are cross-validated with, for instance, in situ hybridizations. It would improve the strength of the claim if some findings, in particular regarding the dynamics of the changes 6 vs 24h after exhaustion bout, were cross-validated.

      (5) Although the authors note as a limitation that cholinergic neurons were underrepresented in their dataset, since one of the main claims of the manuscript relates to them, it calls for some additional comments on the identity of the cholinergic neurons present in their dataset. There are different populations of spinal cholinergic neurons with very different functions. It would greatly improve the strength of this result if the authors could identify which cholinergic neurons show these changes (or at least which proportion of the different cholinergic population is present in their datasets). For instance, which proportion of cholinergic neurons are expressing classical markers of motor neurons versus markers of cholinergic interneurons (for instance, from the V0c population).

    4. Reviewer #3 (Public review):

      Summary:

      Mansingh et al. used single-nucleus transcriptional and bulk proteomic profiling to characterize how gene expression changes in the lumbar spinal cord of adult, healthy mice after training (voluntary wheel-running exercise) and acutely after forced treadmill exercise. They found (1) that training was associated with a number of differentially expressed proteins, (2) training was associated with cell-type specific changes in transcription, notably glial cells had the highest numbers of differentially expressed genes, and (3) that trained mice had blunted transcriptional response to an acute exercise bout compared to sedentary mice.

      Strengths:

      The characterization of the changes to the proteome and the transcriptome associated with exercise will undoubtedly be a useful resource for scientists interested in the effects of exercise on central nervous system gene expression and may inspire mechanistic follow-up studies. The authors nicely use pathway and intercellular communication analyses to distill the complex dataset into key trends.

      Weaknesses:

      Weaknesses of this paper include two aspects of the analyses that underexplored the rich dataset. The analysis fails to explicitly compare the proteome and transcriptome results. Do the differentially expressed proteins correspond to the differentially expressed genes? If so, in which cell types? If not, why not? Comparison of the GO terms from the proteome dataset and the GSEA terms from the single-nucleus transcriptome dataset suggests that the same gene families were not identified in both data sets. I expect that integrating analyses across these datasets would help make the study truly multi-omic and highlight which expression changes are the most abundant and consistent across approaches. Second, the authors emphasize that related studies do not account for inter-individual variability in both the introduction and discussion. This aspect of the authors' dataset is also underexplored - the transcriptomic data appear to be pooled across animals, and only a single panel shows protein expression from individual animals (Fig. 1F). Is the variability in Figure 1F explainable by the amount of running on the wheel?

    1. eLife Assessment

      This study provides important insights into how working memory shapes perceptual decisions, using a dual-task design, continuous mouse tracking, and hierarchical Bayesian modeling. By dissociating fast attentional capture effects from slower, sustained perceptual biases within single trials, the authors provide compelling evidence that working memory-perception interactions unfold through distinct dynamic processes rather than a single mechanism. This work will be of interest to researchers studying working memory, perception, decision-making, and mouse-tracking methodology.

    2. Reviewer #1 (Public review):

      Summary

      This study examines how working memory (WM) influences perceptual decisions, with the aim of distinguishing fast attentional capture-like effects from slower, sustained perceptual biases. The authors use a dual-task design in which a perceptual estimation task is embedded within a WM delay, combined with a time-resolved analysis of mouse tracking reports and hierarchical Bayesian modeling. This approach reveals two temporally distinct signatures of WM-perception interactions within single trials, arguing against a unitary account of WM-driven perceptual bias and instead supporting multiple processes that operate over different timescales.

      Strengths

      A major strength of the study is its innovative use of a time-resolved mouse trajectory analysis to move beyond endpoint measures and reveal the dynamic evolution of decision biases. By decomposing trajectories into components that are and are not explained by the final response, the authors provide compelling evidence for an early transient deviation and a slower, endpoint-consistent drift. The combination of rigorous experimental design, hierarchical Bayesian modeling, and converging analyses yields compelling support for the central claims and offers a valuable framework for studying top-down influences on perception.

      Weaknesses/points requiring clarification:

      (1) The primary weakness concerns the clarity of the theoretical framing linking the identified trajectory components specifically to attentional capture and representational (or perceptual) shift. While the manuscript reviews prior work on attentional and perceptual biases, the conceptual transition to the proposed distinction between capture and representational shift would benefit from a stronger connection to the existing literature. Clarifying this relationship would strengthen the interpretation of the results.

      (2) The use of the term "continuous" to describe the trajectory analyses may be confusing for readers, as it could be interpreted as referring to a continuous task rather than a time-resolved analysis of movements performed to make a discrete response.

      (3) Figures 2 and 7 present posterior distributions of hierarchical Bayesian parameter estimates for endpoint responses in Experiments 1 and 2. However, they do not show how these model estimates relate to the raw behavioral data. Including model fits alongside the observed data would help readers assess the quality of the fits and better evaluate how well the modeling captures the underlying behavioral responses. Similarly, it would be helpful to see individual means in Figure 3a, panel 2, as is done in Figure 4.

    3. Reviewer #2 (Public review):

      Summary:

      This manuscript investigates the mechanisms by which visual working memory (WM) interacts with perceptual judgements, using continuous mouse-tracking to dissociate putative attentional capture from representational shift. Across two experiments, participants maintained a color in WM while performing an intervening perceptual matching task. Analyses of mouse trajectories revealed bidirectional influences with distinct dynamics of attentional capture and representational shift components. For WM's influence on perceptual judgments, trajectories showed a fast and endpoint-inconsistent deviation (interpreted as attentional capture by WM-matching features), followed by a slower and sustained drift that closely matched the final perceptual bias. In contrast, when perceptual judgments influenced subsequent WM recall, trajectory dynamics were dominated by the sustained drift component, with minimal capture-like deviation. Together, these findings are interpreted as evidence that WM shapes perceptual decisions through at least two temporally distinct processes.

      Strengths:

      I find the paradigm to be cleverly designed and the analyses rigorous. A major strength of this work is the use of continuous mouse-tracking and time-resolved analyses to dissociate transient influences from sustained biases within single trials. The trajectory decomposition provides an elegant way to separate early deviations from later drift, which would be difficult to achieve using traditional measures that only measure the final recall. I find the observation particularly compelling that trajectories initially deviate toward WM-matching information and then correct back toward the task-relevant target, highlighting the dynamic interplay between transient priority signals and the final decision.

      Weaknesses:

      (1) The early curvature in the mouse trajectory, inconsistent with the endpoint, is interpreted as fast attentional capture. However, this signal may also reflect competition among multiple responses driven simultaneously by the WM representation and the perceptual matching item. While the current interpretation is plausible, it would be helpful if the authors could more clearly articulate why this component should be solely interpreted as attentional capture rather than early response competition.

      (2) The mouse trajectories show a clear correction back toward the target later in the movement, particularly when the cursor enters the color wheel (Figure 3a), where the correction appears most pronounced. I wonder how this corrective phase should be interpreted. For example, does this correction reflect disengagement from an initial WM-driven priority signal, increasing influence of task demands and sensory evidence, or some other control process?

      Relatedly, movement onset latency modulated the overall AUC but did not influence the final perceptual error. I wonder whether the time courses of the capture and shift components (as revealed by the destination-vector transformation) differ between early-onset and late-onset trials, and if so, when those differences emerge. Explicitly showing these comparisons would help further clarify how early capture is corrected while the endpoint bias remains stable. It may also be informative to include representative raw trajectory paths for early- and late-onset trials, as Figure 3a is currently the only figure showing raw trajectories, whereas most subsequent results are derived measures.

      (3) The contrast in destination-vector dynamics between the perceptual matching response and the WM recall response (Figure 8) is interesting. For the representational shift component, the effect appears to increase sharply after movement onset. Conceptually, one might expect the shift in WM representation to have already occurred following perceptual judgment, rather than emerging during the response itself. It would be helpful if the authors could clarify why the shift is expressed primarily during the movement phase. Additionally, although weak, there appears to be a small capture-like deviation in the WM recall trajectories. Was this effect statistically significant? It may be informative to apply the same cluster-based permutation analysis directly comparing the capture effects against zero, in addition to the paired comparisons currently reported.

    1. eLife Assessment

      This important study investigates the self-assembly activity of all 109 human death-fold domains. The data collected using advanced microscopy and distributed amphifluoric FRET-based flow cytometry methods are compelling to support the "phase change battery" model that explains how signal amplification can occur without ATP consumption. This paper provides new insight into the thermodynamic control of protein phase behaviors within cells and will be of interest to those studying a variety of biological pathways involved in inflammatory responses and various forms of cell death.

    2. Reviewer #1 (Public review):

      This is a high-quality and extensive study that reveals differences in the self-assembly properties of the full set of 109 human death fold domains (DFDs). Distributed amphifluoric FRET (DAmFRET) is a powerful tool that is applied here for a comprehensive examination of the self-assembly behaviour of the DFDs, in non-seeded and seeded contexts, and allows comparison of the nature and extent of self-assembly. The work reveals the nature of the barriers to nucleation in the transition from low to high AmFRET. Alongside analysis of the saturation concentration and protein concentration in the absence of seed, the work demonstrates that the subset of proteins that exhibit discontinuous transitions to higher-order assemblies are expressed more abundantly than DFDs that exhibit continuous transitions. The experiments probing the ~20% of DFDs that exhibit discontinuous transition to polymeric form suggest that they populate a metastable, supersaturated form, in the absence of cognate signal. This is suggestive of a high intrinsic barrier to nucleation.

      The differences in self-assembly behaviour are significant and highlight mechanistic differences across this large family of signalling adapter domains, with identification of a small number of key supersaturated adapters, which exhibit higher centrality within networks, and can amplify signals and transduce them to effectors as required. The description of some supersaturated DFD adaptors as long-term, high-energy storage forms or phase change adaptors is attractive and is a framework that addresses many of the requirements for on-demand signaling and amplification in innate immunity. The identification of only a small number of key adaptors and high specificity suggests a mechanism for insulation of pathways from each other and minimisation of aberrant lethal consequences.

      An optogenetic approach is applied to initiate self-assembly of CASP1 and CASP9 DFDs, as a model for apoptosome initiation in these two DFDs with differing continuous or discontinuous assembly properties. This comparison reveals clear differences in the stability and reversibility of the assemblies, supporting the authors' hypothesis that supersaturation-mediated DFD assembly underlies signal amplification in at least some of the DFDs. The study also reveals interesting correlations between supersaturation of DFD adapters in short- and long-lived cells, suggestive of a relationship between mechanism of assembly and cellular context. Additionally, the interactions are almost all homomeric or limited to members of the same DFD subfamily or interaction network and examination of bacterial proteins from innate immunity operons suggest that their polymerisation could be driven by similar mechanisms. Future detailed studies that probe the roles and activities of DFDs identified with continuous or discontinuous barriers to nucleation, through mutational analysis, in chimeric proteins and with high resolution studies of the assemblies, can build on this methodology and database.

      The Discussion effectively places this work in the context of innate immunity effectors and adapters, explains and provides a justification of the phase change material analogy, and contrasts this mechanism with phase separation. The breadth and depth of the experimental investigations allow a new view of the role of nucleation barriers and supersaturation in DFD assembly and innate immunity pathways.

    3. Reviewer #2 (Public review):

      This work studies the self-association behavior of 109 human Death Fold Domains (DFD) in eukaryotic cells and its connection to their function in innate immune signalosomes.

      Using an amphifluoric FRET (DAmFRET) method previously developed by the authors, self-association is monitored as a function of protein concentration by Förster Resonance Energy Transfer in the cell.

      Several DFDs are found to be in a supersaturable state and are considered energy reservoirs necessary for signal amplification.

      The revised manuscript addresses most of the original concerns, resulting in a significant improvement.

      The following observations are made:

      (1) A group of DFDs shows a bimodal FRET distribution of no FRET and high FRET values at low and high protein concentration, which indicates a nucleation barrier. This conclusion is corroborated by the modification from a discontinuous to a continuous FRET transition by expressing a structural template or seed. The authors find that DFDs displaying discontinuous FRET behavior are supersaturated, and those that retain their discontinuous behavior in the context of the full-length protein correspond to protein adaptors of innate immune signalosomes.

      (2) The authors indicate that the adaptors of inflammatory signalosomes act as energy reservoirs for signal amplification. This is not demonstrated, but it is assumed that the energy stored in the supersaturated state is released upon polymerization.

      (3) This work also includes evidence showing that nonsupersaturable and supersaturable constructs of caspase-9 form puncta that dissolve or persist, respectively, upon apoptosome stimulation. The supersaturable construct also induces massive cell death, in contrast to the nonsupersaturable form. Although not demonstrated, these results could be related to the level of signal amplification.

      (4) The cell's lifespan depends on the supersaturation levels of certain DFDs.

      (5) Polymerization nucleated by interaction between DFDs from different pathways (different signalosomes) is rare.

      (6) The study demonstrates the presence of nucleation barriers, inferred from supersaturable conditions, in the adaptor orthologs of zebrafish (Danio rerio) and the model sponge Amphimedon queenslandica, which indicates that this characteristic is conserved.

    4. Author response:

      The following is the authors’ response to the current reviews.

      Both reviewers indicated broad approval of the revised work, for which we are grateful.

      Reviewer #1 requested no further changes.

      Reviewer #2’s Public review states:

      The authors indicate that the adaptors of inflammatory signalosomes act as energy reservoirs for signal amplification. This is not demonstrated, but it is assumed that the energy stored in the supersaturated state is released upon polymerization.

      The “assumed” link between supersaturation and energy release is in fact a thermodynamic necessity. Supersaturation is, by definition, a high free energy state. Our data shows that triggering nucleation via optogenetics results in an immediate avalanche of polymerization and cell death. This is not an assumption; it is a direct observation of work performed by the system when the kinetic barrier is removed.

      Reviewer #2 recommended:

      Ideally, signal amplification could be tested by determining the levels of the final product, e.g., cytokines, activated caspases...

      We did measure CASP3/7 activation, demonstrating a correlation with supersaturation of upstream adaptors. We do agree however that measuring the levels of other signaling products, including for each of the supersaturated pathways, would strengthen our claims. This will be the subject of future work.

      The authors indicate a significant anticorrelation between the saturating concentrations and the transcript abundances (Figure 2B), reporting an R = -0.285.

      This is correct… no change appears to be requested or warranted.


      The following is the authors’ response to the original reviews.

      Public Reviews:

      Reviewer #1 (Public review):

      Summary:

      This is a high-quality and extensive study that reveals differences in the self-assembly properties of the full set of 109 human death fold domains (DFDs). Distributed amphifluoric FRET (DAmFRET) is a powerful tool that reveals the self-assembly behaviour of the DFDs, in non-seeded and seeded contexts, and allows comparison of the nature and extent of self-assembly. The nature of the barriers to nucleation is revealed in the transition from low to high AmFRET. Alongside analysis of the saturation concentration and protein concentration in the absence of seed, the subset of proteins that exhibited discontinuous transitions to higher-order assemblies was observed to have higher concentrations than DFDs that exhibited continuous transitions. The experiments probing the ~20% of DFDs that exhibit discontinuous transition to polymeric form suggest that they populate a metastable, supersaturated form in the absence of cognate signal. This is suggestive of a high intrinsic barrier to nucleation.

      Strengths:

      The differences in self-assembly behaviour are significant and likely identify mechanistic differences across this large family of signalling adapter domains. The work is of high quality, and the evidence for a range of behaviours is strong. This is an important and useful starting point since the different assembly mechanisms point towards specific cellular roles. However, understanding the molecular basis for these differences will require further analysis.

      An impressive optogenetic approach was engineered and applied to initiate self-assembly of CASP1 and CASP9 DFDs, as a model for apoptosome initiation in these two DFDs with differing continuous or discontinuous assembly properties. This comparison revealed clear differences in the stability and reversibility of the assemblies, supporting the hypothesis that supersaturation-mediated DFD assembly underlies signal amplification in at least some of the DFDs.

      The study reveals interesting correlations between supersaturation of DFD adapters in short- and long-lived cells, suggestive of a relationship between the mechanism of assembly and cellular context. Additionally, the comprehensive nature of the study provides strong evidence that the interactions are almost all homomeric or limited to members of the same DFD subfamily or interaction network. Similar approaches with bacterial proteins from innate immunity operons suggest that their polymerisation may be driven by similar mechanisms.

      Weaknesses:

      Only a limited investigation of assembly morphology was conducted by microscopy. There was a tendency for discontinuous structures to form fibrillar structures and continuous to populate diffuse or punctate structures, but there was overlap across all categories, which is not fully explored.

      We agree that an in-depth exploration of aggregate morphology would be interesting, but we feel it has limited relevance to the central findings of the manuscript. Our analysis established a relationship between discontinuous transitions and ordering based on the assumption that ordered assembly by DFDs involves polymerization, for which there is much precedent in the literature. Nevertheless, polymers of similar structure can form with different kinetics and hence, polymerization does not by itself imply an ability to supersaturate. We see this empirically in the “fibrillar” column in Fig. 1B. We have now elaborated this important point more fully in the relevant results section and in the discussion. Only five of the 108 DFDs in Fig. 1B warrant additional explanation. CASP4<sup>CARD</sup> and IFIH1<sup>tCARD</sup> lacked AmFRET but formed puncta; this could result from interactions with endogenous structures or condensates. DAPK1<sup>DD</sup> and UNC5A<sup>DD</sup> were classified as continuous (low) and fibrillar, but their AmFRET values are in fact higher than monomer control revealing that the fibrils simply comprise a small fraction of the protein. The puncta of UNC5A<sup>DD</sup> additionally do not resemble the fibrillar puncta of other DFDs; we suspect it may be a false-positive resulting from localization to mitochondrial or other intracellular membranes. Finally, CASP2<sup>CARD</sup> was inadvertently classified as punctate; this turns out to have been a technical artifact that has now been corrected (the fibrils wrapped around the cell perimeter to form ring-like puncta with anomalously low aspect ratios). We have now updated the methods section describing manual validation of our automated classification procedure, including which samples required reclassification. We have also now included all microscopy data in the public repository accompanying this manuscript.

      The methodology used to probe oligomeric assembly and stability (SDD-AGE) does not justify the conclusions drawn regarding stability and native structure within the assemblies.

      The reviewer is correct that SDD-AGE does not provide evidence against non-amyloid misfolding. It merely provides evidence that the DFDs are not forming amyloid (which are characteristically sarkosyl resistant). We have revised the sentence and further clarified that the distinction with amyloid specifically is important because amyloid is the only known form of ordered assembly (other than DFD polymers) with a nucleation barrier large enough to support deep supersaturation. Together with the series of interfacial mutants tested (and shown to impede assembly in all cases), the lack of sarkosyl-resistance provides evidence that the discontinuous DFDs are assembling through canonical DFD subunit interfaces.

      The work identifies important differences between DFDs and clearly different patterns of association. However, most of the detailed analysis is of the DFDs that exhibit a discontinuous transition, and important questions remain about the majority of other DFDs and why some assemblies should be reversible and others not, and about the nature of signalling arising from a continuous transition to polymeric form.

      We focused on discontinuous DFDs because this property allows for executive control over their respective pathways. They make signaling switch-like, which we argue is essential for innate immune responses. By contrast, and as illustrated in Figure 6D, supersaturation is required for a DFD to drive its own polymerization -- hence activation for a continuous DFD must be stoichiometrically coupled either with D/PAMP binding or positive feedback from downstream or orthogonal processes. We consider the principles underlying such regulation of signaling to be better established and understood than supersaturation, and hence built our narrative for this manuscript around the latter. Our original text addresses the fact that only a small fraction of DFDs are discontinuous. Specifically, this is expected in light of the fact that a) only one supersaturated DFD is needed to make a signaling pathway switch-like, and b) every supersaturated DFD renders the cell susceptible to spontaneous death. Evolution should therefore limit supersaturation to only the highly connected DFDs (i.e. adaptors), which is what is seen. In this view, the many nonsupersaturable DFDs have evolved to accessorize the central supersaturable DFDs with various sensor and effector modules. Our revised text attempts to further clarify this perspective.

      Some key examples of well-studied DFDs, such as MyD88 and RIPK,1 deserve more discussion, since they display somewhat surprising results. More detailed exploration of these candidates, where much is known about their structures and the nature of the assemblies from other work, could substantiate the conclusions here and transform some of the conclusions from speculative to convincing.

      We were likewise initially surprised about the inability of MyD88 and RIPK1 to supersaturate. We have now elaborated in the Discussion how our findings can be rationalized by the apparent supersaturability of other adaptors in MyD88 and RIPK1 signaling pathways. We additionally discuss prior evidence that MyD88 may indeed be supersaturable, and how our experimental system could have led to a false positive in the unique case of MyD88.

      The study concludes with general statements about the relationship between stochastic nucleation and mortality, which provide food for thought and discussion but which, as they concede, are highly speculative. The analogies that are drawn with batteries and privatisation will likely not be clearly understood by all readers. The authors do not discuss limitations of the study or elaborate on further experiments that could interrogate the model.

      We have now added to the discussion a section on the limitations of our study. We appreciate that our use of “privatisation” was confusing and have omitted it. However, we consider the battery analogy to accurately convey the newfound function of DFDs and anticipate that this analogy will ultimately prove valuable for biologists. To facilitate comprehension, we have now broadened our description of phase change batteries in the introduction.

      Reviewer #2 (Public review):

      Summary:

      The manuscript from Rodriguez Gama et al. proposes several interesting conclusions based on different oligomerization properties of Death-Fold Domains (DFDs) in cells, their natural abundance, and supersaturation properties. These ideas are:

      (1) DFDs broadly store the cell's energy by remaining in a supersaturated state;

      (2) Cells are constantly in a vulnerable state that could lead to cell death;

      (3) The cell's lifespan depends on the supersaturation levels of certain DFDs.

      Overall, the evidence supporting these claims is not completely solid. Some concerns were noted.

      Strengths:

      Systematic analysis of DFD self-assembly and its relationship with protein abundance, supersaturation, cell longevity, and evolution.

      Weaknesses:

      (1) On page 2, it is stated, "Nucleation barriers increase with the entropic cost of assembly. Assemblies with large barriers, therefore, tend to be more ordered than those without. Ordered assembly often manifests as long filaments in cells," as a way to explain the observed results that DFDs assemblies that transitioned discontinuously form fibrils, whereas those that transitioned continuously (low-to-high) formed spherical or amorphous puncta. It is unlikely to be able to differentiate between amorphous and structured puncta by conventional confocal microscopy. Some DFDs self-assemble into structured puncta formed by intertwined fibrils. Such fibril nets are more structured and thus should be associated with a higher entropic cost. Therefore, the results in Figure 1B do not seem to agree with the reasoning described.

      The formation of microscopically visible elongated structures necessitates ordering on the length scale of 100s of nanometers. Otherwise surface tension would favor rounded aggregates. Conventional confocal microscopy is in fact well-suited and widely used to distinguish ordered from disordered assemblies in cells based on this principle.1,2 We are unaware of any examples of isolated DFDs forming regular polymers that manifest as round puncta or nets. The reviewer may be referring to full-length ASC, which forms a roughly spherical mesh of filaments because it has two DFDs joined by a flexible linker. This is not applicable to our analysis with single DFDs. Single DFDs polymerize in effectively one dimension; hence a spherical punctum formed by a single DFD can only happen through noncanonical interactions or clustering of small filaments, both of which reduce order relative to long filaments.

      (2) Errors for the data shown in Figure 1B would have been very useful to determine whether the population differences between diffuse, punctate, and fibrillar for the continuous (low-to-high) transition are meaningful.

      We have now performed two statistical analyses to address this. First, using Fisher’s exact test, we observe a highly significant association between the DAmFRET and morphology classifications (p-value: 0.0001). Second, to specifically address whether the continuous (low to high) category has a preferred morphology, we applied an Exact Multinomial Test using the total frequencies of each morphology. This test revealed that all categories are significantly enriched for particular morphologies, as now indicated in the figure and legend.

      (3) A main concern in the data shown in Figure 1B and F is that the number of counts for discontinuous compared to continuous is small. Thus, the significance of the results is difficult to evaluate in the context of the broad function of DFDs as batteries, as stated at the beginning of the manuscript.

      Fig. 1B simply reports the numerical intersections between fluorescence distribution classifications and DAmFRET classifications. In Fig. 1F, our use of the chi-square test is justified by a sufficiently large sample size. Nevertheless, we obtain similar results with Fisher's exact test that accounts for smaller sample size (Odds Ratio: 75.0, P-value: < 0.0001). See also our response to the related critique by Reviewer 1 regarding the small number of discontinuous DFDs.

      (4) The proteins or domains that are self-seeded (Figure 1F) should be listed such that the reader has a better understanding of whether domains or full-length proteins are considered, whether other domains have an effect on self-seeding (which is not discussed), and whether there is repetition.

      We define and consistently use “DFDs” to refer to domains, and “FL” or “DFD-containing protein” to refer to FL proteins. The Figure 1 title and corresponding section title both indicate the data refer to “DFDs”. The text callout for Figure 1F also directs readers to Table S1 where we believe the self-seeding results and details of constructs are clearly presented. There is no repetition. We have modified the legend to clarify that “Each DFD was co-expressed with an orthogonally fluorescent μNS-fused version of the same DFD.” We did not systematically evaluate seeding of FL proteins. We did however previously test self-seeding on seven representative FL proteins, and have now included those data in a new supplemental figure (S5). In short, only FL proteins with discontinuous distributions are self-seedable. These are limited to adaptors that had discontinuous seedable DFDs, revealing no adverse effect of FL protein context on seedability of adaptors (unlike receptors and effectors).

      (5) The authors indicate an anticorrelation between transcript abundance and Csat based on the data shown in Figure 2B; however, the data are scattered. It is not clear why an anticorrelation is inferred.

      An anticorrelation is indicated by the clearly placed negative R value at the top of the graph and the figure legend describing the statistical analysis.

      (6) It would be useful to indicate the expected range of degree centrality. The differences observed are very small. This is specifically the case for the BC values. The lack of context and the small differences cast doubts on their significance. It would be beneficial to describe these data in the context of the centrality values of other proteins.

      The possible range of centrality scores is 0 - 1, where 1 represents a protein interacting with every other protein in the network (degree centrality) or is on the shortest path between every other pair of proteins in the network (betweenness centrality). The expected range is difficult to address, as centrality values strongly depend on the size and function of the network. We considered that the SAM domain network could provide the most relevant comparison to the DFD network, as SAM domains resemble DFDs in size and structure, function heavily in signaling, are comparably numerous (76 in humans), and many of them form homopolymers (but importantly of a geometry that does not support nucleation barriers). We found that SAM domains have much lower betweenness centrality in their physical interaction network as compared to discontinuous DFDs (p = 0. 0003) while their degree centrality is not significantly different (Figure S3F). Nevertheless, we stress that what matters for our conclusion is that the continuous and discontinuous values are significantly different among DFDs. Since there is a large overlap in the distributions of centrality scores between the two classes of DFDs, we performed a more robust permutation test with the Mann Whitney U statistic and n = 10000. These tests reiterated that continuous and discontinuous DFDs have significantly different centrality scores (Degree centrality p = 0.008; Betweenness centrality p = 0.028) (Figure S3E).

      (7) Page 3 section title: "Nucleation barriers are a characteristic feature of inflammatory signalosome adaptors." This title seems to contradict the results shown in Figure 2D, where full-length CARD9 and CARD11 are classified as sensors, but it has been reported that they are adaptor proteins with key roles in the inflammatory response. Please see the following references as examples: The adaptor protein CARD9 is essential for the activation of myeloid cells through ITAM-associated and Toll-like receptors. Nat Immunol 8, 619-629 (2007), and Mechanisms of Regulated and Dysregulated CARD11 Signaling in Adaptive Immunity and Disease. Front Immunol. 2018 Sep 19;9:2105. However, both CARD9 and CARD11 show discontinuous to continuous behavior for the individual DFDs versus full-length proteins, respectively, in contrast to the results obtained for ASC, FADD, etc.

      We rigorously counter the inconsistent usage of the term “adaptor” in the signalosome literature by quantifying the centrality of each protein in the physical interaction network of DFD proteins. Such analysis shows that BCL10, which is also described as an adaptor, is the more central member of the CARD9 and CARD11 (CBM signalosome) pathways, and is therefore more “adaptor-like”. We have now elaborated this view in the text.

      FADD plays a key role in apoptosis but shows the same behavior as BCL10 and ASC. However, the manuscript indicates that this behavior is characteristic of inflammatory signalosomes. What is the explanation for adaptor proteins behaving in different ways? This casts doubts about the possibility of deriving general conclusions on the significance of these observations, or the subtitles in the results section seem to be oversimplifications.

      We agree that our initial presentation of these results and brief description of each protein’s function was insufficient to fully justify our conclusions. We have now elaborated that while FADD was historically considered an adaptor of extrinsic apoptosis, it is now appreciated as a pleiotropic molecule with both anti- and pro-inflammatory signaling functions. FADD’s pro-inflammatory roles include inflammasome activation and activating NF-kB through the FADDosome. We have now revised our section headings to avoid oversimplification.

      (8) IFI16-PYD displays discontinuous behavior according to Figure S1H; however, it is not included in Figure 2D, but AIM 2 is.

      We only tested a subset of FL proteins spanning different functions within diverse signalosomes. IFI16 was not included. Hence it could not be meaningfully included in Fig. 2D.

      (9) To demonstrate that "Nucleation barriers facilitate signal amplification in human cells," constructs using APAF1 CARD, NLRC4 CARD, caspase-9 CARD, and a chimera of the latter are used to create what the authors refer to as apoptsomes. Even though puncta are observed, referring to these assemblies as apoptosomes seems somewhat misleading. In addition, it is not clear why the activity of caspase-9 was not measured directly, instead of that of capsae-3 and 7, which could be activated by other means.

      We agree that describing our chimeric assemblies as “apoptosomes” could be misleading, and have now refrained from doing so. We measured caspase-3/7 instead of caspase-9 for purely technical reasons -- we were unable to find any reliable caspase-9 activity assays that were also compatible with our optogenetic and imaging wavelengths. In any case, our data with the widely used caspase3/7 reporter dyes confirm comparably effective signal propagation from the CASP9 versions to their relevant endogenous substrate for apoptotic signaling (pro-caspase-3/7). The subsequent differences in cell death efficiency between the two versions of CASP9 (Fig. 3E) cannot be attributed to indirect effects of blue light stimulation, because both versions received the same treatment. Note our stated justification for using these DFDs in the HEK293T background is that these cells lack NLCR4 and CASP1 proteins and therefore the activity we measure is due to the direct optogenetic activation.

      The polymerization of caspase-1 CARD with NLRC4 CARD, leading to irreversible puncta, could just mean that the polymers are more stable. In fact, not all DFDs form equally stable or identical complexes, which does not necessarily imply that a nucleation barrier facilitates signal amplification. Could this conclusion be an overstatement?

      Figure 3C shows that the polymers don’t simply persist following the transient stimulus -- they continue to grow. That is, the soluble protein continues to join the polymers for a net increase even though there is no longer a stimulus directing them to do so. This means the drive to polymerize is independent of the stimulus, i.e. the protein is supersaturated. In the absence of supersaturation, a difference in stability would simply change the rates at which the polymers shrink. That we see continued growth instead of shrinkage therefore cannot be explained just by a difference in stability. Nevertheless, the reviewer’s critique caused us to realize that increased persistence of the CASP1CARD polymers could contribute to signal amplification independently of supersaturation if they act catalytically (i.e. where each polymerized CASP9 subunit sequentially activates multiple CASP3/7 molecules), and we had not adequately considered this. Unfortunately, the relevant experimentalist has now moved on from the lab leaving us unable to conduct the necessary experiments to resolve these two effects in a timely fashion. Consequently, we have now tempered our interpretation of these data. 

      (10) To demonstrate that "Innate immune adaptors are endogenously supersaturated," it is stated on page 5 that ASC clusters continue to grow for the full duration of the time course and that AIM2-PYD stops growing after 5 min. The data shown in Figure 4F indicate that AIM2-PYD grows after 5 mins, although slowly, and ASC starts to slow down at ~ 13 min. Because ASC has two DFDs, assemblies can grow faster and become bigger. How is this related to supersaturation?

      That AIM2-PYD assemblies appear to grow somewhat (although not significantly statistically) would be consistent with AIM2-PYD’s sequestration into the growing ASC clusters. All that matters for our conclusion regarding ASC is that ASC assemblies grow following cessation of the stimulus, which we now describe quantitatively. Supersaturation is defined as the ratio of total concentration to saturating concentration, which is an equilibrium property. For a given protein concentration, the presence of two DFDs, each contributing their own interactions to overall stability of the assembly, will increase supersaturation relative to the individual DFDs. Importantly, growth will not occur if the protein concentration lies below its C<sub>sat</sub>, no matter how many DFDs it has.

      Recommendations for the authors:

      Reviewer #1 (Recommendations for the authors):

      It isn't clear what is implied by the final sentence of the Abstract. Some of the conclusions have a speculative tone and would be better described in less certain terms. The final sentence of the abstract should be omitted.

      We have revised the abstract to add appropriate nuance but consider the final sentence to be both justified by our data and important to convey our findings to a broad audience.

      How does the size and nature of the seed influence the outcome of these DFD interactions? Although some non-seeded experiments are described, the majority of the results are derived from seeded experiments. Further details about the seeds should be included. How is the size of the nucleus controlled, and will seeds of smaller or larger size generate the same pattern of results?

      This is a very important question! The seeds comprised genetic fusions of each DFD to a condensate-forming domain, as described. While this system is insufficient to explore the size-dependence of nucleation, we are developing tools to do exactly that, for example our recently published multivalent nanobody against mEos3,[3] wherein we piloted its use to compare the size-dependence of ASC versus amyloid nucleation. Much further work will be needed to fully utilize this approach for the question of interest, and that is the subject of ongoing but open-ended work in the lab.

      What is the implication of the observation that only ~20% of the DFDs exhibited a discontinuous transition from no to high AmFRET signal? Further discussion of the DFDs that exhibit a continuous transition would enrich the manuscript.

      We consider the relationship to mortality important for understanding this observation. In the discussion we now explain that each supersaturated protein in a death-inducing pathway imposes a risk of unintentional death. We speculate that evolution therefore minimizes the number of supersaturated DFDs by restricting them to central nodes in the network. That way, a small number of supersaturable DFDs can be continuously “repurposed” with new receptor proteins for each D/PAMP. Additionally, as stated in our response to the related critique, we felt it was important to focus this manuscript on the novel concept of functional supersaturation necessarily at the expense of signaling regulation through better understood mechanisms.

      Were the initial experiments with DFDs unseeded (Figure S1, F-G)? Clarify this in the text. The morphologies of all the subcellular assemblies appear similar. It is not possible to distinguish between long filaments and spherical or amorphous puncta (Figure S1F-G). Higher magnification images that allow evaluation and comparison of morphology should be provided.

      The initial experiments were unseeded, as now clarified in the legend. We believe there was a misinterpretation resulting from both panels (S1F and G) showing fibrillar examples. To clarify, we have now added panel S1H showing representative DFDs classified as “punctate”, which we hope the reviewer agrees are clearly distinct from fibrillar.

      The ASC and CARD14 assemblies in Figure S1G show very distinct fibrillar structures emerging from the mNS-DFD seeds. Please provide further explanation of the nature of these. Do these resemble ASC and CARD assemblies generated as a result of native stimuli rather than mNS-DFD seeds?

      The μNS-DFD puncta contain numerous seeding competent sites, which presumably causes multiple fibrils to initiate and emanate from them. This and potential bundling of these fibrils produces the star-like shape. We have no reason to believe the internal structure of these fibers differs from native signalosome assemblies. For example, point mutations at native subunit interfaces that were previously shown to disrupt fibrilization and signaling likewise disrupt assembly in our DAmFRET experiments (Figure S2A). To our knowledge there exist no examples of high-resolution DFD fibril structures that were induced by native stimuli. However, recent work using super-resolution imaging confirmed that nigericin-triggered endogenous ASC specks comprise a network of filaments that superficially resembles our star-like assemblies.[4]

      Figure S2B is presented as evidence that assembly is mediated by native-like interfaces rather than amyloid-like misfolding. These SDD-Age gels cannot be used to infer a native-like structure for the protein within the assemblies, only that the assemblies are (mostly) solubilised by incubation with sarkosyl. Many misfolding but non-amyloid-structure assemblies could be consistent with these results. Additionally, several of the samples appear to show insoluble aggregates within the wells, which could also be consistent with amyloid-type structures. What is the nature of these aggregates? Why is the NLRP3PYD sample so much more intense than the others? Why was FL-ZBP1 included when it does not contain a DFD? Why were no sarkosyl-resistant assemblies observed with RIPK3-RHIM when this is known to be highly amyloidogenic?

      ZBP1 and RIPK3<sup>RHIM</sup> were one of multiple proteins inadvertently included on the complete gel shown in the original figure that is not relevant to the manuscript; we have now spliced out these unnecessary lanes (indicated with dashed lines) to avoid confusion. We have found that the specific fragment of RIPK3<sup>RHIM</sup> used in this experiment -- residues 446-464 -- does not allow for robust amyloid formation. We believe this is a steric artifact due to its small size (19 residues) relative to the fused mEos3, because a longer fragment (446-518) forms amyloid robustly. However the latter construct was not available at the time this experiment was done. Nevertheless, another known amyloid protein, RIPK1<sup>RHIM</sup>, does show the expected smears on this gel and suffices for the positive control for amyloid. We do not understand why the NLRP3<sup>PYD</sup> sample is more intense than the others. However, this anomaly does not impact our conclusion that DFDs do not form sarkosyl-resistant smears that would be indicative of amyloid.

      Expand on the concept of autoinhibited oligomerisation. Is this due to structural features? What might be the advantage of autoinhibited oligomerisation for these DFDs?

      We have elaborated on this section in the results.

      End of page 3, which "former set of adaptors" are referred to here? This is ambiguous.

      We have replaced “former” with “innate immune”.

      Page 5, the authors state that a kinetic barrier governs the activity of inflammatory signalosomes. While under the circumstances generated in this particular system, there is a kinetic barrier to the formation of large fibrillar complexes, can the same be said to be true in cells that respond to signals? They experience a specific triggering event. This should be redrafted to distinguish between the specific trigger in cells (downstream of a binding-driven event) and the kinetic barrier to self-association observed in this model system.

      Yes, our findings establish that a kinetic barrier governs signalosome activation. By engineering a triggering event that is more specific than natural triggering events (see Figure 3), we exclude the possibility that the cell first responds to the signal to create conditions that stabilize inflammasome formation. This means that regardless of what may happen with a natural trigger, the driving force for assembly clearly pre-exists and is therefore held in check by a kinetic barrier.

      On page 6, the statement "...lifespan may be limited by the thermodynamic drive for inflammatory signal amplification" is not clear. While this is strictly true following the initial triggering event, isn't lifespan limited by the stochastic activation? These very general statements stray beyond what can be substantiated on the basis of the data presented here.

      We believe the source of confusion here was our misuse of the term “lifespan”. We have now replaced it with “life expectancy”, which we believe is substantiated by our statements as written.

      Overall, the work presents a compelling, comprehensive analysis of the seeded self-assembly of DFDs. It identifies distinct properties for assembly of these domains that may underlie their particular physiological roles. However, some of the statements are quite general and not substantiated.

      Page 6. Is "end cell fate" the intended phrase?

      We have revised the phrase.

      The data regarding conservation of DFD-like modules and activity is interesting and probably deserves inclusion. However, without substantial evidence of expression levels (i.e., results) and a more complete understanding of these other systems, the statement "These results suggest that the function of DFDs as energy reservoirs preceded the evolution of animals" appears as an over-reach.

      We demonstrated that sequence-encoded nucleation barriers of DFDs are shared across animal signalosomes (human, zebrafish, sponge). This is not trivial as such nucleation barriers are uncommon even among targeted screens of prion-like proteins.5 Therefore, they appear to have existed in the basal animal. We have now omitted the data concerning bacterial DFDs as these systems are indeed much less understood, and the concerned pathways lack the tripartite architecture of animal signalosomes. We therefore revised the sentence in question by replacing “evolution” with “radiation”.

      Only a small number of DFDs exhibit this behaviour, so why is the conclusion drawn that energy storage for on-demand signalling may be the principal ancestral function of DFDs?

      The totality of the data supports this conclusion. Briefly (but elaborated in the text), 1) intrinsic nucleation barriers are unusual even among self-associating proteins, the vast majority of which (e.g. condensates) would suffice for the only other major function ascribed to DFDs -- bringing effectors close enough for proximity-dependent activation (which has been repeatedly demonstrated in DFD-replacement experiments), 2) nucleation barriers are nevertheless conserved in innate immune signaling pathway, 3) that they are limited to approximately one DFD in each pathway is consistent with evolutionary selection to minimize accidental death.

      Are there any other adapters like MyD88 that are inconsistent with this hypothesis? Are any others known to be controlled by oligomer formation? How strong is the evidence for hexameric oligomers? If there is a threshold size for oligomers, how does this differ from a stable seed/nucleus that triggers assembly, as in the discontinuous transition?

      These are all good questions related to critiques that we have now addressed.

      The use of the term "privatisation" is likely not consistently understood across the community and should be explained. Is it simply meant to imply independent operation? How is it actually different from other forms of deployment of DFDs that exhibit continuous assembly? Are they not also independent? What is implied by the opposite of privatisation here? The term may introduce ambiguity in this context.

      We have now omitted this term.

      Is there strong evidence that well-validated physiologically relevant LLPS systems exhibit supersaturation at concentrations that are very different from those of the DFDs examined in this study?

      No, and this is a major point. As discussed in the text (with references), LLPS is incompatible with cell-wide supersaturation to a comparable magnitude as crystalline transitions, which precludes them from driving signal amplification. This helps to explain why the active state of DFD assemblies is ordered, when it has been repeatedly demonstrated that signal propagation itself does not require ordering.

      The paragraph discussing TIR domains and functional amyloids would be enhanced with a comparison of amyloid systems where seeded nucleation results in assembly of a polymer with significant conformational change in the constituent monomers.

      We do not yet understand how DFDs (and TIR domains) in some cases exhibit amyloid-like nucleation barriers without overt conformational differences between monomers and polymers. Work is underway in the lab to test specific hypotheses, but such discussion would be too speculative for the present paper.

      The statement "High specificity also insulates pathways from each other" should be elaborated to discuss the issue of highly similar monomers that apparently assemble into filamentous forms with minimal structural rearrangement. How is the specificity generated?

      We have elaborated the paragraph.

      The final paragraph is speculative and utilises language that detracts from the quality and rigour of the study. While important principles have been revealed, more discussion of the limitations of the work would allow readers to evaluate the significance of the study and could be used to effectively stimulate further efforts to study the multiple different mechanisms that underpin critical signalling pathways in innate immunity and control cell fate.

      We have now revised the final paragraph and included an extensive discussion of the limitations of the work.

      Reviewer #2 (Recommendations for the authors):

      (1) For clarity, it would be useful to include the names of the proteins in the bottom table of STable1, and such information at the top and bottom tables can be connected.

      We are unable to determine what is meant by this suggestion. Table S1 does not have a “top” and “bottom table”. Every entry in Table S1 and S2 contains the protein name, its most frequently used alias in the literature (when not the official name), and the corresponding Uniprot protein ID.

      (2) The language used in the abstract makes analogies between scientific and mundane terms, which compromises clarity. For example, what is meant by the terms shown below?

      (a) "......specifically templated by other DFDs....."

      We have revised this phrase.

      (b) "...function like batteries, storing and converting energy for life-or-death decisions."

      Batteries convert chemical energy into electrical energy or thermal energy. What is the electrical energy produced by DFDs? Is there any evidence that DFDs change the temperature of the cells or transfer heat?

      We have now included a familiar example of a thermal battery that operates analogously to the manner we show for DFDs. As now elaborated extensively, such batteries operate via a physical rather than chemical process -- a change in the state of matter (solute to crystalline) of a supersaturated “phase change material” (this is an established term). This is exactly what we show is happening for DFDs. While it would be illustrative to measure the heat released upon DFD polymerization in cells, the much faster rate of heat transfer relative to molecular diffusion makes that impossible with present methods. Nevertheless, such measurements are unnecessary because disorder-to-order phase transitions are fundamentally exothermic.

      (c) "....privatizing..."

      We now avoid this term.

      Using appropriate scientific terms to explain the scientific results presented in this manuscript will increase clarity. Analogously, it is difficult to understand what the title of the manuscript means, "Protein phase change batteries..."

      We appreciate this critique and have removed “batteries” from the title to make the work more accessible to biologists. However, we reject the implication that such terminology is inappropriate. We presume the reviewer meant “unfamiliar” instead of “inappropriate”. The well-reasoned application of terms from other fields is standard practice and arguably essential to convey new concepts in biology. The modern biology lexicon is built on this. For example, Robert Hooke co-opted “cell” from the architecture of monasteries. More recently cell biologists appropriated “condensates” from soft matter physics. In both cases, the term while initially foreign to biologists usefully introduced a concept that lacked recognized precedent in biology. Similarly, “phase change battery” provides an accurate analogy for the central finding of our work, and we have now elaborated this analogy in the text.

      Bibliography

      (1) Garcia-Seisdedos, H., Empereur-Mot, C., Elad, N. & Levy, E. D. Proteins evolve on the edge of supramolecular self-assembly. Nature 548, 244–247 (2017).

      (2) Alberti, S., Halfmann, R., King, O., Kapila, A. & Lindquist, S. A systematic survey identifies prions and illuminates sequence features of prionogenic proteins. Cell 137, 146–158 (2009).

      (3) Kimbrough, H. et al. A tool to dissect heterotypic determinants of homotypic protein phase behavior. Protein Sci. 34, e70194 (2025).

      (4) Glück, I. M. et al. Nanoscale organization of the endogenous ASC speck. iScience 26, 108382 (2023).

      (5) Posey, A. E. et al. Mechanistic inferences from analysis of measurements of protein phase transitions in live cells. J. Mol. Biol. 433, 166848 (2021).

    1. eLife Assessment

      The authors present useful findings demonstrating that the RNA modification enzyme Mettl5 regulates sleep in Drosophila. Through transcriptome- and proteome-wide analyses, the authors identified downstream targets affected in heterozygous mutants and proposed that Mettl5 regulates the translation and degradation of clock genes to maintain normal sleep function. Through additional analyses, the authors provided solid evidence that Mettl5 regulates translation and degradation of clock genes to maintain normal sleep cycle. The mechanistic details of Mettl5 is unclear and requires further support.

    2. Reviewer #1 (Public review):

      Here, the authors attempted to test whether the function of Mettl5 in sleep regulation was conserved in drosophila, and if so, by which molecular mechanisms. To do so they performed sleep analysis, as well as RNA-seq and ribo-seq in order to identify the downstream targets. They found that the loss of one copy of Mettl5 affects sleep, and that its catalytic activity is important for this function. Transcriptional and proteomic analyses show that multiple pathways were altered, including the clock signaling pathway and the proteasome. Based on these changes the authors propose that Mettl5 modulate sleep through regulation of the clock genes, both at the level of their production and degradation, possibly by altering the usage of Aspartate codon.

      Comments on revised version:

      The authors satisfactorily addressed my comments, even though the precise mechanism by which Mettl5 regulates translation of clock genes remains to be firmly demonstrated.

    3. Reviewer #3 (Public review):

      Xiaoyu Wu and colleagues examined a potential role in sleep of a Drosophila ribosomal RNA methyltransferase, mettl5. Based on sleep defects reported in CRISPR generated mutants, the authors performed both RNA-seq and Ribo-seq analyses of head tissue from mutants and compared to control animals collected at the same time point. A major conclusion was that the mutant showed altered expression of circadian clock genes, and that the altered expression of the period gene in particular accounted for the sleep defect reported in the mettl5 mutant. In this revision, the authors have added a more thorough analysis of clock gene expression and show that PER protein levels are increased relative to wild type animals a specific times of day, indicating increased stability of the protein. Given that PER inhibits its own transcription, the per RNA is low in the mutants. Efforts toward a more detailed understanding of how clock gene expression was altered in the mutants, as well as other clarification of sleep phenotypes throughout is appreciated. As noted above, a strength of this work is its relevance to a human developmental disorder as well as the transcriptomic and ribosomal profiling of the mutant. However, there still remain some minor weaknesses in the manuscript. This reviewer is not in agreement with the interpretation of the epigenetic experiments. Specifically, co-expression of Clk[jrk] or per[01] with the mettl5 mutant recovered the nighttime sleep phenotype, but was additive to the daytime sleep phenotype such that double mutants showed higher sleep. This effect should be acknowledged and discussed. Overall, this is an interesting paper that indicates a molecular link between mettl5 and the circadian clock in regulation of sleep.

    4. Author response:

      The following is the authors’ response to the original reviews.

      Public Reviews:

      Reviewer #1 (Public review):

      Summary:

      Here the authors attempted to test whether the function of Mettl5 in sleep regulation was conserved in drosophila, and if so, by which molecular mechanisms. To do so they performed sleep analysis, as well as RNA-seq and ribo-seq in order to identify the downstream targets. They found that the loss of one copy of Mettl5 affects sleep and that its catalytic activity is important for this function. Transcriptional and proteomic analyses show that multiple pathways were altered, including the clock signaling pathway and the proteasome. Based on these changes the authors propose that Mettl5 modulate sleep through regulation of the clock genes, both at the level of their production and degradation.

      Strengths:

      The phenotypical consequence of the loss of one copy of Mettl5 on sleep function is clear and well-documented.

      Weaknesses:

      The imaging and molecular parts are less convincing.

      - The colocalization of Mettl5 with glial and neuronal cells is not very clear

      We truly appreciate your suggestion. We repeated the staining experiments. To ensure better results, we tried another antibody of ELAV (mouse) and optimized the experimental conditions. This result has been included in the Figure S1 of the revised version.

      - The section on gene ontology analysis is long and confusing

      The session is revised for clarity. To get a better flow of logic, we deleted the paragraph which describing the details of Figure S6.

      - Among all the pathways affected the focus on proteosome sounds like cherry picking. And there is no experiment demonstrating its impact in the Mettl5 phenotype

      Thank you for the comments. The changes of period oppositely at transcriptional versus translational levels puzzled us a while until we found the ubiquitin pathway components changes. The regulation of Period protein degradation by ubiquitin-proteasome pathway has been well documented (Grima et al., 2002; Ko et al., 2002; Chiu et al., 2008). In addition, previous reports indicated that N6 methyladenosine (m6A) regulates ubiquitin proteasome pathway in skeletal muscle physiology (Sun et al., 2023). This information has been included in the revised manuscript in the last paragraph under the title: Mettl5 regulates the clock gene regulatory loop.

      Indeed, we haven’t found a proper way to manipulate proteasome levels in genetic tests. Proteasome is a large protein complex which is composed of many subunits. Enhancing the its activity by overexpressing its components was not applicable. Moreover, proteasome has important function during many biological processed. Disrupting its function by simply MG132 treatment which we tried results in lots of side effects.

      In this study, we also noticed the codon usage alteration caused by mettl5 mutant. Please refer to the answers to the following question for details. Previous reports also found the regulation of mettl5 on translation in other systems (Rong et al, 2020; Peng et al., 2022). Based on these analyses, it is possible that both the regulation on translation and protein degradation contributed the period protein upregulation found in mettl5 mutant. This idea has been included in the Discussion session of the revised manuscript.

      References

      Sun J, Zhou H, Chen Z, et al. Altered m6A RNA methylation governs denervation-induced muscle atrophy by regulating ubiquitin proteasome pathway. J Transl Med. 2023;21(1):845. Published 2023 Nov 23. doi:10.1186/s12967-023-04694-3

      Grima, B. et al. The F-box protein slimb controls the levels of clock proteins period and timeless. Nature 420, 178–182 (2002).

      Ko, H. W., Jiang, J. & Edery, I. Role for Slimb in the degradation of Drosophila period protein phosphorylated by doubletime. Nature 420, 673–678 (2002).

      Chiu, J. C., Vanselow, J. T., Kramer, A. & Edery, I. The phosphooccupancy of an atypical SLIMB-binding site on PERIOD that is phosphorylated by DOUBLETIME controls the pace of the clock. Genes Dev. 22, 1758–1772 (2008).

      - The ribo seq shows some changes at the level of translation efficiency but there is no connection with the Mettl5 phenotypes. In other words, how the increased usage of some codons impact clock signalling. Are the genes enriched for these codons?

      Thank you for raising this point. In our analysis, we observed an increased usage of the codons for Asp in the Mettl5 mutant. Prior work has reported a possible connection between codon usage and per protein activity. In the report, a per version with optimized codon cannot rescue circadian rhythmicity caused by per mutant, in contrast to WT version (Fu J et al. 2016). Further study indicated that dPER protein levels were also elevated in the mutant flies, suggesting a role for codon optimization in enhancing dPER expression (Figure 2B in Fu J et al. 2016). Consistent with this, we analyzed the region of codon optimization in Fu J et al. 2016. The result indicated that that GAC has a relatively high usage rate in these regions (indicated in the following two Author response image charts by the red arrow), suggesting that the Mettl5 mutation may influence per protein accumulation through altered GAC usage. Further experiments are needed to confirm this possibility. We included these details in the second last paragraph of the Discussion session.

      Author response image 1.

      15-21

      SDSAYSN

      Author response image 2.

      43-316

      SSGSSGYGGKPSTQASSSDMIIKRNKEKSRKKKKPKCIALATATTVSLEGTEESPLPANGGCEKVLQELQDTQQLGEPLVVTETQLSEQLLETEQNEDQNKSEQLAQFPLPTPIVTTLSPGIGPGHDCVGGASGGAVAGGCSVVGAGTDKTSELIPGKLESAGTKPSQERPKEESFCCVISMHDGIVLYTTPSISDVLGFPRDMWLGRSFIDFVHHKDRATFASQITTGIPIAESRGCMPKDARSTFCVMLRRYRGLNSGGFGVIGRAVNYEPF

      Fu J, Murphy KA, Zhou M, Li YH, Lam VH, Tabuloc CA, Chiu JC, Liu Y. Codon usage affects the structure and function of the Drosophila circadian clock protein PERIOD. Genes Dev. 2016 Aug 1;30(15):1761-75.

      - A few papers already demonstrated the role of Mettl5 in translation, even at the structural level (Rong et al, Cell reports 2020) and this was not commented by the authors. In Peng et al, 2022 the authors show that the m6A bridges the 18S rRNA with RPL24. Is this conserved in Drosophila?

      Thanks for the reminder. We discussed and cited these papers in the revised version.

      Rong B, Zhang Q, Wan J, et al. Ribosome 18S m<sup>6</sup>A Methyltransferase METTL5 Promotes Translation Initiation and Breast Cancer Cell Growth. Cell Rep. 2020;33(12):108544. doi:10.1016/j.celrep.2020.108544

      Peng H, Chen B, Wei W, et al. N<sup>6</sup>-methyladenosine (m<sup>6</sup>A) in 18S rRNA promotes fatty acid metabolism and oncogenic transformation. Nat Metab. 2022;4(8):1041-1054. doi:10.1038/s42255-022-00622-9

      - The text will require strong editing and the authors should check and review extensively for improvements to the use of English.

      Thanks. The text of the paper are thoroughly revised.

      Conclusion

      Despite the effort to identify the underlying molecular defects following the loss of Mettl5 the authors felt short in doing so. Some of the results are over-interpreted and more experiments will be needed to understand how Mettl5 controls the translation of its targets. References to previous works was poorly commented.

      Thanks for your suggestion. We have incorporated the references mentioned above. However, our efforts have thus far fallen short of elucidating a precise picture of METTL5's functional mechanism. To address this, the limitations of the current study have been discussed more thoroughly in the revised main text.

      Reviewer #2 (Public review):

      Summary:

      The authors define the m6A methyltransferase Mettl5 as a novel sleep-regulatory gene that contributes to specific aspects of Drosophila sleep behaviors (i.e., sleep drive and arousal at early night; sleep homeostasis) and propose the possible implication of Mettl5-dependent clocks in this process. The model was primarily based on the assessment of sleep changes upon genetic/transgenic manipulations of Mettl5 expression (including CRISPR-deletion allele); differentially expressed genes between wild-type vs. Mettl5 mutant; and interaction effects of Mettl5 and clock genes on sleep. These findings exemplify how a subclass of m6A modifications (i.e., Mettl5-dependent m6A) and possible epi-transcriptomic control of gene expression could impact animal behaviors.

      Strengths:

      Comprehensive DEG analyses between control and Mettl5 mutant flies reveal the landscape of Mettl5-dependent gene regulation at both transcriptome and translatome levels. The molecular/genetic features underlying Mettl5-dependent gene expression may provide important clues to molecular substrates for circadian clocks, sleep, and other physiology relevant to Mettl5 function in Drosophila.

      Weaknesses:

      While these findings indicate the potential implication of Mettl5-dependent gene regulation in circadian clocks and sleep, several key data require substantial improvement and rigor of experimental design and data interpretation for fair conclusions. Weaknesses of this study and possible complications in the original observations include but are not limited to:

      (1) Genetic backgrounds in Mettl5 mutants: the heterozygosity of Mettl5 deletion causes sleep suppression at early night and long-period rhythms in circadian behaviors. The transgenic rescue using Gal4/UAS may support the specificity of the Mettl5 effects on sleep. However, it does not necessarily exclude the possibility that the Mettl5 deletion stocks somehow acquired long-period mutation allelic to other clock genes. Additional genetic/transgenic models of Mettl5 (e.g., homozygous or trans-heterozygous mutants of independent Mettl5 alleles; Mettl5 RNAi etc.) can address the background issue and determine 1) whether sleep suppression tightly correlates with long-period rhythms in Mettl5 mutants; and 2) whether Mettl5 effects are actually mapped to circadian pacemaker neurons (e.g., PDF- or tim-positive neurons) to affect circadian behaviors, clock gene expression, and synaptic plasticity in a cell-autonomous manner and thereby regulate sleep. Unfortunately, most experiments in the current study rely on a single genetic model (i.e., Mettl5 heterozygous mutant).

      We believe that the multiple rescue experiments presented in Figure 1H-L and Figure 2H-L have effectively addressed the background concern. To further confirm this, we have subsequently repeated sleep and circadian rhythm assays using RNAi lines, aiming to further eliminate any remaining concerns in this regard. It appears to replicate the reduced sleep phenotype seen at night. This result has been included in the Figure S1. It is true that we have not specifically addressed whether the effects of Mettl5 are mapped to circadian pacemaker neurons in this study. We acknowledge this as a limitation and appreciate the importance of this question. Further investigations focusing on circadian pacemaker neurons, such as PDF- or tim-positive neurons, would be necessary to clarify the precise role of Mettl5 in regulating circadian behaviors and related molecular mechanisms.

      (2) Gene expression and synaptic plasticity: gene expression profiles and the synaptic plasticity should be assessed by multiple time-point analyses since 1) they display high-amplitude oscillations over the 24-h window and 2) any phase-delaying mutation (e.g., Mettl5 deletion) could significantly affect their circadian changes. The current study performed a single time-point assessment of circadian clock/synaptic gene expression, misleading the conclusion for Mettl5 effects. Considering long-period rhythms in Mettl5 mutant clocks, transcriptome/translatome profiles in Mettl5 cannot distinguish between direct vs. indirect targets of Mettl5 (i.e., gene regulation by the loss of Mettl5-dependent m6A vs. by the delayed circadian phase in Mettl5 mutants).

      In the revised version, we provided data collected at multiple time points. Specifically, we reexamined the per expression at both transcriptional and translational levels at different timepoints. The corresponding results were incorporated in Figure 4 D-F. We also dissected fly brains from UAS-DenMark, UAS-syt.eGFP/+; pdf-GAL4/+ and UAS-DenMark, UAS-syt.eGFP/+; pdf-GAL4/Mettl5<sup>1bp</sup> at these four time points to quantify the synaptic structures of PDF neurons. The result has been included in revised Figure 6.

      (3) The text description for gene expression profiling and Mettl5-dependent gene regulation was very detailed, yet there is a huge gap between gene expression profiling and sleep/behavioral analyses. The model in Figure 5 should be better addressed and validated.

      Thank you for your suggestion. We added data to better confirm the expression changes of PER protein at different time points. Indeed, what you mention is the weak point of this paper. We did analysis thoroughly during the revision process.

      The opposing changes in Period at the transcriptional versus translational levels puzzled us for some time until we identified alterations in the ubiquitin pathway components. The regulation of Period protein degradation by the ubiquitin-proteasome pathway is well-documented (Grima et al., 2002; Ko et al., 2002; Chiu et al., 2008). Additionally, previous studies have shown that N6-methyladenosine (m6A) modulates the ubiquitin-proteasome pathway in skeletal muscle physiology (Sun et al., 2023). We have incorporated this information into the revised manuscript in the last paragraph under the section titled: Clock gene regulatory loop regulating circadian rhythm was affected by Mettl5<sup>1bp</sup>

      Indeed, we have not yet identified an effective method to manipulate proteasome levels in genetic tests. The proteasome is a large protein complex composed of numerous subunits, making it impractical to enhance its activity simply by overexpressing individual components. Furthermore, the proteasome plays a critical role in many biological processes. Disrupting its function—such as through MG132 treatment, which we attempted—leads to significant off-target effects.

      Sun J, Zhou H, Chen Z, et al. Altered m6A RNA methylation governs denervation-induced muscle atrophy by regulating ubiquitin proteasome pathway. J Transl Med. 2023;21(1):845. Published 2023 Nov 23. doi:10.1186/s12967-023-04694-3

      Grima, B. et al. The F-box protein slimb controls the levels of clock proteins period and timeless. Nature 420, 178–182 (2002).

      Ko, H. W., Jiang, J. & Edery, I. Role for Slimb in the degradation of Drosophila period protein phosphorylated by doubletime. Nature 420, 673–678 (2002).

      Chiu, J. C., Vanselow, J. T., Kramer, A. & Edery, I. The phosphooccupancy of an atypical SLIMB-binding site on PERIOD that is phosphorylated by DOUBLETIME controls the pace of the clock. Genes Dev. 22, 1758–1772 (2008).

      Reviewer #3 (Public review):

      Xiaoyu Wu and colleagues examined the potential role in sleep of a Drosophila ribosomal RNA methyltransferase, mettl5. Based on sleep defects reported in CRISPR generated mutants, the authors performed both RNA-seq and Ribo-seq analyses of head tissue from mutants and compared to control animals collected at the same time point. While these data were subjected to a thorough analysis, it was difficult to understand the relative direction of differential expression between the two genotypes. In any case, a major conclusion was that the mutant showed altered expression of circadian clock genes, and that the altered expression of the period gene in particular accounted for the sleep defect reported in the mettl5 mutant. As noted above, a strength of this work is its relevance to a human developmental disorder as well as the transcriptomic and ribosomal profiling of the mutant. However, there are numerous weaknesses in the manuscript, most of which stem from misinterpretation of the findings, some methodological approaches, and also a lack of method detail provided. The authors seemed to have missed a major phenotype associated with the mettl5 mutant, which is that it caused a significant increase in period length, which was apparent even in a light: dark cycle. Thus the effect of the mutant on clock gene expression more likely contributed to this phenotype than any associated with changes in sleep behavior.

      Recommendations for the authors:

      Reviewer #1 (Recommendations for the authors):

      Some of the questions that the authors should address are the following ones:

      How does Mettl5 control the translation of the clock genes ? Why the level of some genes are specifically increased or decreased? What is the relation with the effect on uORF and dORF, overlapping and non overlapping ones? The observation of these defects is interesting but how they occurs and how they impact clock signaling is missing.

      Thank you for your suggestion. This is the weak point of this paper. We did analysis thoroughly during the revision process.

      The opposing changes in Period at the transcriptional versus translational levels puzzled us for some time until we identified alterations in the ubiquitin pathway components. The regulation of Period protein degradation by the ubiquitin-proteasome pathway is well-documented (Grima et al., 2002; Ko et al., 2002; Chiu et al., 2008). Additionally, previous studies have shown that N6-methyladenosine (m6A) modulates the ubiquitin-proteasome pathway in skeletal muscle physiology (Sun et al., 2023). We have incorporated this information into the revised manuscript in the last paragraph under the section titled: Clock gene regulatory loop regulating circadian rhythm was affected by Mettl5<sup>1bp</sup>.

      Indeed, we have not yet identified an effective method to manipulate proteasome levels in genetic tests. The proteasome is a large protein complex composed of numerous subunits, making it impractical to enhance its activity simply by overexpressing individual components. Furthermore, the proteasome plays a critical role in many biological processes. Disrupting its function—such as through MG132 treatment, which we attempted—leads to significant off-target effects.

      In this study, we also observed codon usage alterations caused by the mettl5 mutant. For details, please refer to our responses to 4th question of the weakness session above. Previous studies have reported mettl5's role in translational regulation in other systems (Rong et al., 2020; Peng et al., 2022). Based on these findings, we propose that both translational regulation and protein degradation may contribute to the upregulation of Period protein in the mettl5 mutant. This hypothesis has been included in the Discussion section of the revised manuscript.

      “The mechanism by which METTL5 regulates translation warrants further investigation. Previous studies have demonstrated that METTL5 influences translation (Rong et al., 2020; Peng et al., 2022), but whether the mechanisms identified here are conserved across other systems remains an intriguing question. In our analysis, we observed increased usage of aspartate (Asp) codons in Mettl5 mutants. Notably, prior work has linked codon usage to PER protein function—specifically, a codon-optimized version of PER failed to rescue circadian rhythmicity in per mutant flies, unlike the wild-type version (Fu et al., 2016). Further analysis revealed that PER protein levels were elevated in these mutants, suggesting that codon optimization enhances PER expression (Figure 2B in Fu et al., 2016). Strikingly, when we examined the codon-optimized region from Fu et al. (2016), we found that GAC (Asp) was highly enriched, raising the possibility that Mettl5 mutation affects PER protein accumulation by altering GAC codon usage. Additional experiments will be needed to validate this hypothesis. Furthermore, we detected changes in upstream open reading frames (uORFs) in Mettl5 mutants, but their relationship to translational regulation requires further exploration.”

      References

      Sun J, Zhou H, Chen Z, et al. Altered m6A RNA methylation governs denervation-induced muscle atrophy by regulating ubiquitin proteasome pathway. J Transl Med. 2023;21(1):845. Published 2023 Nov 23. doi:10.1186/s12967-023-04694-3

      Grima, B. et al. The F-box protein slimb controls the levels of clock proteins period and timeless. Nature 420, 178–182 (2002).

      Ko, H. W., Jiang, J. & Edery, I. Role for Slimb in the degradation of Drosophila period protein phosphorylated by doubletime. Nature 420, 673–678 (2002).

      Chiu, J. C., Vanselow, J. T., Kramer, A. & Edery, I. The phosphooccupancy of an atypical SLIMB-binding site on PERIOD that is phosphorylated by DOUBLETIME controls the pace of the clock. Genes Dev. 22, 1758–1772 (2008).

      Rong B, Zhang Q, Wan J, et al. Ribosome 18S m<sup>6</sup>A Methyltransferase METTL5 Promotes Translation Initiation and Breast Cancer Cell Growth. Cell Rep. 2020;33(12):108544. doi:10.1016/j.celrep.2020.108544

      Peng H, Chen B, Wei W, et al. N<sup>6</sup>-methyladenosine (m<sup>6</sup>A) in 18S rRNA promotes fatty acid metabolism and oncogenic transformation. Nat Metab. 2022;4(8):1041-1054. doi:10.1038/s42255-022-00622-9

      Fu J, Murphy KA, Zhou M, Li YH, Lam VH, Tabuloc CA, Chiu JC, Liu Y. Codon usage affects the structure and function of the Drosophila circadian clock protein PERIOD. Genes Dev. 2016 Aug 1;30(15):1761-75.

      Reviewer #2 (Recommendations for the authors):

      Please find my comments to improve the quality of your manuscript.

      Major comments

      (1) The quality of text writing in English needs to be at publishable levels. It is not a trivial problem, but it literally impairs the readability of your work. So please have professionals edit your manuscript text appropriately.

      We have carefully revised the language throughout the manuscript during the revision process.

      (2) Fig 1O: please include the total sleep profile and other analyses for rebound sleep phenotypes in control vs. Mettl5 to better validate that both genotypes were comparably sleep-deprived, but the latter shows less sleep rebound.

      Thank you for your suggestion, The other reviewer also suggested to reanalyze the sleep rebound data. We did the analysis according to the following reference. We included data sleep profiles of both genotypes in original Fig 1O. Total sleep profile and other analyses for rebound sleep phenotypes are included in the revised panel. As shown in this revised panel (now Figure 1K, L), both genotypes were comparably sleep-deprived.

      Cirelli C, Bushey D, Hill S, Huber R, Kreber R, Ganetzky B, Tononi G. 2005. Reduced sleep in Drosophila Shaker mutants. Nature 434:1087-92.

      (3) Line 90: the authors did not actually address this critical question. Additional Gal4 mapping (e.g., Mettl5 rescue or Mettl5 RNAi) will determine which cells/neural circuits are important for Mettl5-dependent sleep.

      This sentence has been revised into “The observed expression pattern of Mettl5 further supports its sleep regulatory function.”

      (4) Fig 1H-L; Fig 2H-L: the authors should check if overexpression of wild-type or mutant Mettl5 in control backgrounds could affect nighttime sleep to better define the transgenic effects among overexpression, rescue, and dominant-negative.

      Thank you for the comment. We added the overexpression phenotypes in the revised version.

      (5) Lines 225-226. Fig S11: The neural projections from PDF-expressing neurons should be better imaged and quantified. Current images can visualize PDF projections onto the optic lobe but not others (e.g., dorsal, POT), so the conclusion is not validated.

      Thank you for the suggestion. We acknowledge the limitation in the current images of PDF-expressing neuronal projections. We included new, higher-resolution images to better visualize and quantify the neural projections, including the dorsal and POT regions, to ensure the conclusion is well-supported.

      (6) Lines 230-232: per RNA/PER protein expression oscillates daily, so the authors should perform time-point experiments to conclude Mettl5 effects on clock gene expression, including per.

      Thank you for the insightful comment. We performed experiments in the Mettl5 mutant background at four time points to analyze PER protein expression using both RT-PCR and Western blot (anti-PER). The updated results have been included in Figure 4D-F.

      (7) Lines 235-238: the authors should note that Mettl5 effects on sleep in Clk or per mutant backgrounds are actually opposite to those in w1118/control one. Mettl5 deletion promotes daytime or nighttime sleep in Clk or per mutants, respectively. Any explanation? 

      We are trying to use epistasis analysis to determine which gene is upstream here. Epistasis (or epistatic effect) in genetics refers to the interaction between different genes where the expression of one gene (the epistatic gene) masks or modifies the expression of another gene (the hypostatic gene). The epistatic gene (masking gene) usually functions downstream in the pathway because its effect overrides the output of the hypostatic gene. The double mutant showed the similar phenotype as downstream genes. Thus, Clk or per functions downstream of Mettl5.

      (8) Fig 6: The dorsal PDF projections actually show time-dependent plasticity. Results from the single time-point are not conclusive.

      Thank you for the insightful comment. we further dissected fly brains from UAS-DenMark, UAS-syt.eGFP/+; pdf-GAL4/+ and UAS-DenMark, UAS-syt.eGFP/+; pdf-GAL4/Mettl5<sup>1bp</sup> at these four time points to analyze the morphology of PDF neurons. The results have been included in figure 6.

      Minor comments

      (1) Please avoid simple bar graphs in the data presentation-include individual data points or use a different graph showing the distribution of raw data (e.g., violin plot, box plot, etc.).

      Thank you for the suggestion. In the revised version of the manuscript, we have included individual data points, violin plots, and box plots to present the data, effectively showing both the distribution and differences in the raw data.

      (2) Line 19: "Clock" indicates the gene name or general terminology such as "circadian clock". Please clarify it and revise the font accordingly.

      This has been revised into“clock”

      (3) The overall flow in the Abstract/Summary is somewhat challenging for a general audience to follow.

      We have revised the text, especially the overall flow in the Abstract/Summary.

      (4) Fonts for the names of genes and gene products (i.e., mRNA, protein) should be appropriately corrected throughout the manuscript.

      We have checked the text and made changes where necessary.

      (5) Methods: the authors should provide detailed information on the methods. For instance, there is little description of how they generate Mettl5 deletions (e.g., sgRNA/target sequence). Also, they should clarify whether they test heterozygous vs. homozygous mutants of Mettl5 deletions in each experiment since the genotype description in the figure appears mixed-up (e.g., Fig 1B vs. Fig 1I-L).

      Thank you for pointing this out. In the updated version, we provided detailed information about the strains used, including the sgRNA/target sequences for generating Mettl5 deletions. Regarding the genotypes, Figure 1B represents homozygous mutants, while Figures 1I-L represent heterozygous mutants. This distinction has been clarified in the figure legends, and the genotype notation for Figures 1I-L will be revised for consistency and clarity.

      (6) Fig 1: the figure panels should be re-arranged based on the order of their text description (i.e., Fig 1H-L should go after Fig 1M-O).

      Thank you for the suggestion. In the revised version, we rearranged the figure panels so that Figures 1H-L appear after Figures 1M-O, following the order of their description in the text.

      (7) Sleep education in Trmt112 RNAi looks different from that in Mettl5 mutant het. Any explanation?

      The functional divergence between Trmt112 and Mettl5 may also contribute to the observed sleep phenotype. While Trmt112 and Mettl5 share some downstream targets, they each regulate many unique genes, some of which could influence sleep. Sleep is a highly sensitive trait that can be modulated by numerous genetic factors. Previous studies have also suggested that sleep behaves more like a quantitative trait, reflecting the combined effects of multiple genes (Mackay and Huang, 2018).

      Mackay TFC, Huang W. Charting the genotype-phenotype map: lessons from the Drosophila melanogaster Genetic Reference Panel. Wiley Interdiscip Rev Dev Biol. 2018;7(1):10.1002/wdev.289. doi:10.1002/wdev.289

      Reviewer #3 (Recommendations for the authors):

      A detailed critique is provided below. Generally, the authors can greatly improve this manuscript if they focus more rigorously on the circadian phenotype associated with the Mettl5 mutant, which could be the basis for the apparent sleep phenotype.

      (1) Please provide more information as to how each of the mettl5 mutants were generated. This information should include, specifically, the gRNA sequences, plasmids generated for the 5' and 3' arms, and anything related to the CRISPR approach for generating the mutants. Was any sequencing done to verify the CRISPR alleles, or was this limited to the analysis of mettl5 expression and behavior? Please indicate where the qPCR primers (used in Fig 1B) are located relative to the mutant loci. The figure legend is also incomplete in that there is no reference to the boxed area in Fig 1A.

      In the updated version, we have provided detailed information about the how each of the mettl5 mutants were generated. The sequence was verified by sequencing following PCR. The following references to the boxed area were added in the revised version.

      Reference

      Iyer LM, Zhang D, Aravind L. Adenine methylation in eukaryotes: Apprehending the complex evolutionary history and functional potential of an epigenetic modification. Bioessays. 2016 Jan;38(1):27-40. doi: 10.1002/bies.201500104.

      (2) As noted, I am not in agreement with the interpretation of findings for the sleep defect reported in the mettl5[1b]/+ mutants. There is a clear increase in morning sleep in the mutants that may not have reached significance by lumping the data in 12h increments (Fig1C-E). Were the overall 24h sleep values between the mutants and controls the same? The sleep profile appears to be shifted, such that nighttime sleep onset in the mutants occurs much later than wild type, and daytime waking is also much later, all pointing to a long period phenotype, which is very strongly supported by the data in Table 1, as well as the RNA- and ribo-seq data. The implications for this leading to sleep disturbances in humans is very exciting. An additional suggestion to the authors here is to report the nighttime sleep latency values (time to onset of the first sleep bout after lights off).

      We appreciate your insightful observation. As shown in Table 1, the Mettl51bp/+ mutant exhibits a robust long-period phenotype, with circadian rhythms significantly extended to 28.3 ± 0.4 hours compared to the wild-type's 23.9 ± 0.05 hours. This prolonged period perfectly aligns with the observed behavioral phenotypes, including delayed nighttime sleep onset, later daytime waking, and the overall shift in sleep profile. This is indeed quite similar to previous report on Period3 variant (Zhang et al., 2016). We agree that the prolonged circadian period contributes to the observed sleep phenotype. However, since total sleep time was significantly reduced in the mutant, we cannot attribute the phenotype solely to period lengthening. Furthermore, our 24-hour PER expression analysis in mettl5 mutants revealed elevated PER protein levels at ZT1 and ZT18, while ZT6 and ZT12 showed no significant changes, with no apparent phase shift. These findings collectively suggest that the phenotype primarily results from PER protein stabilization and accumulation.

      Importantly, genetic rescue experiments restoring wild-type Mettl5 function (UAS-Mettl5/Mettl5-Gal4; Figure 1 and Table 1) completely normalized the circadian period to 24 ± 0.02 hours, providing compelling evidence that these phenotypes specifically result from loss of Mettl5 function. Together with the sleep architecture data, these findings establish Mettl5 as a crucial regulator of circadian rhythms, with important implications for understanding human sleep disorders. To further substantiate these observations, we have now included quantitative nighttime sleep latency measurements in the revised manuscript to better document the delayed sleep onset in mutants (Figure S1G).

      We have discussed this in the third paragraph of the Discussion session and included the reference in the revised manuscript.

      Zhang L, Hirano A, Hsu PK, et al. A PERIOD3 variant causes a circadian phenotype and is associated with a seasonal mood trait. Proc Natl Acad Sci U S A. 2016;113(11):E1536-E1544. doi:10.1073/pnas.1600039113.

      (3) The description for how circadian behavior was measured and analyzed (Table 1) is missing from the methods section.

      We have included a detailed description of the methods used to measure and analyze circadian behavior, as presented in Table 1, in the revised methods “Sleep behavior assays” section.

      (4) Please explain what the "awake %" values reported in Figs 1G, 1L, Fig 2G, and 2L, Fig 4G and 4M are. Is this simply the number of flies that are awake at a given time point? This does not provide useful information beyond what is already reported for the sleep profiling in other parts of these figures. If it is an arousal threshold assay, as shown in supplementary Fig 1H, please indicate this. The description for "sleep arousal" in the methods (lines 368-371) is also concerning. If most of the mutant flies are already awake at ZT 14, then I would expect that this assay would not work at this time of day. A more suitable time point would be ZT 19, or later, when the mutants are falling asleep. Moreover, calculating the number of flies awakened as long as 5 minutes after a stimulus pulse cannot be distinguished from a spontaneous awakening, and so is not really a metric of arousal threshold. The number of sleeping flies awakened by the stimulus should be calculated within, at most, one minute afterward.

      Thank you for your suggestion. Regarding the 'awake %' metric, it indicates that at specific time points (e.g., ZT14), the percentage of awake fruit fly population at that moment. In the revised version, we further clarify the definition and significance of 'awake %'. Additionally, we have reevaluated the time points for the arousal threshold assay, selecting a more appropriate time (e.g., ZT19) to better reflect the sleep state of the mutants. Based on your suggestion, we calculate the number of flies awakened within one minute after the stimulus to ensure a more accurate measurement of arousal threshold. This has been included in the revised Figure 1M.

      (5) Fig1M-O is problematic. First, is it possible that expression of Mettl5 mRNA fluctuates with time-of-day and is not affected by sleep loss? There are no undisturbed controls collected at equivalent time points. The method used for quantifying sleep rebound in Fig 1O (lines 365-367) does not make sense, as negative values would be expected. Moreover, since the Mettl5 mutants show high sleep amounts in the morning and very low sleep amounts from ZT 12-18, this analysis would be severely confounded. Also, the sleep deprivation applied would not produce equivalent amounts of sleep loss as compared to wild type controls, so this also needs to be corrected. The authors should consider consulting Cirelli et al (2005, DOI: 10.1038/nature03486 ) as an approach for quantifying sleep homeostasis in a short-sleeping mutant. Please also show the sleep profiling in the mutants for these experiments.

      Thank you for your valuable suggestions. Regarding the possibility that Mettl5 mRNA expression fluctuates with circadian rhythms rather than being affected by sleep deprivation, we acknowledge that collecting undisturbed control samples at equivalent time points would provide critical insights. In the revised version, we included undisturbed controls to distinguish between circadian-driven fluctuations and the effects of sleep deprivation on Mettl5 expression.

      For the quantification of sleep rebound in Figure 1O, we agree that the current method may not fully capture the dynamics of sleep recovery, especially in Mettl5 mutants, where sleep patterns differ significantly from wild-type. We have referred to the method proposed by Cirelli et al. paper for quantifying sleep homeostasis in short-sleeping mutants, ensuring a more accurate evaluation of sleep rebound. The results have been included in Figure 1K-L of the revised version.

      (6) Fig 3B and C (minor) - while the volcano plots are clear, it is not clear whether "down" or "up" means for the mutant relative to wild type or the other way around? Please clarify. In Fig 3P, the legend indicates a depiction of the "top 5 pathway associated genes", but it seems there are 10 pathways depicted. Which of these are the "top 5"?

      In the volcano plots (Fig. 3B and 3C), “up” and “down” refer to genes that the mutant relative to the wild-type strain. In Fig. 3P, the legend was mislabeled as “top 5” pathway-associated genes. In fact, we displayed the top 10 pathway-associated genes. We apologize for the confusion and will correct both the figure legend and the corresponding text in our revised manuscript.

      (7) Fig 4 D-E, and F,G do not have sufficient information to draw the conclusion that Per mRNA/protein expression is increased in the Mettl5 mutant. Since both mRNA protein of this gene oscillates significantly throughout the day, it is still possible that the single time point shown in this figure might indicate a disruption in cycling rather than overall expression level. Please first indicate what time of day the tissue was collected, second, consider adding more time points to both assays. For the first part of this figure, A and B, per and Clock gene expression are expected to be in different phases, and so this aspect is not unexpected. However, it is notable that it is reversed in the mutant vs wild type. Again, an alternate interpretation of this finding that the authors have not considered is a change in period duration of gene cycling.

      Thank you for your suggestion. For the PER WB experiments, we have included multiple time points in the revised version to more comprehensively evaluate PER expression in the Mettl5 mutant and better understand its circadian rhythm changes. We appreciate your observation regarding the potential changes in the period duration of gene cycling. This has been discussed in the 3<sup>rd</sup> paragraph of the Discussion session of the revised version.

      (8) The data shown in Figs 4H-M does not support the conclusion that "Clock and Per genes were downstream of Mettl5" (line 236-237). The daytime sleep phenotype, in particular, appears additive between both circadian genes and mutant because the morning sleep of the double mutant is much higher than either mutant by itself. Statistical comparisons between the double mutant and each clock mutant are also noticeably missing. These data are difficult to interpret. One potential explanation is that Mettl5 alters gene expression of non-circadian genes, and that the phenotypes become additive when both clock and Mettl5 genes are missing. A full molecular analysis of clock gene cycling in the Mettl5 mutant may help improve understanding of the relationship between the circadian clock Mettl5 gene expression. It may also be worthwhile checking whether Mettl5 gene expression itself shows a daily oscillation.

      Thank you for your suggestion. In the revised version, we have included four additional time points to analyze the oscillatory expression of Per and Clock in the Mettl5 mutant, providing a more comprehensive understanding of their circadian rhythm changes. In Figs 4H-M, we are trying to use epistasis analysis to determine which gene is upstream here. Epistasis (or epistatic effect) in genetics refers to the interaction between different genes where the expression of one gene (the epistatic gene) masks or modifies the expression of another gene (the hypostatic gene). The epistatic gene (masking gene) usually functions downstream in the pathway because its effect overrides the output of the hypostatic gene. The double mutant showed the similar phenotype as downstream genes. Thus, Clk or per functions downstream of Mettl5. Statistical comparisons between the double mutant and each clock mutant are added.

      (9) In Fig 6, what time of day were the flies collected? PDF terminal morphology is known to change throughout the day; this is another piece of data that could indicate a defect in circadian function rather than a chronic change in synaptic morphology.

      The flies were collected around ZT14. We included additional dissection time points in future experiments. Differences between the control and Mettl5 mutants are observed consistently across multiple time points, suggesting that Mettl5 has an impact on synaptic plasticity.

      Minor:

      There are letter indicators, presumably for statistical comparisons, depicted in Figs 1 and 2 (panels I-L), but no explanation as to what these mean in the figure legends.

      We have added notes in the revised version.

      What is the purpose of the boxed regions shown in Fig S1A-F? There is no explanation of these in the figure legend nor in the text.

      The boxed regions highlight the significant co-localization of two proteins. We have included this explanation in the figure legend in the revised version.

      The statement (lines 310-311) that per and clock genes "exhibit more pronounced sleep rebound after sleep deprivation" is inaccurate. The article cited for this (Shaw et al 2002) showed that it was female mutants of the cycle gene which showed prolonged sleep rebound; other clock mutants were normal.

      Thank you for pointing out this. We revised the statement accordingly.

      Overall, the manuscript may benefit from editing or writing assistance to improve the language. There were many incomplete sentences, grammatical errors, etc.

      We have carefully refined the language throughout the manuscript during the revision process.

    1. eLife Assessment

      This fundamental work advances our understanding of the role of human hippocampal theta oscillations in memory encoding and retrieval. The evidence supporting the conclusions is convincing, using both scopolamine administration and intracranial EEG recordings. This work will be of broad interest to neuroscientists and has translational implications.

    2. Reviewer #1 (Public review):

      Summary:

      The authors report intracranial EEG findings from 12 epilepsy patients performing an associative recognition memory task under the influence of scopolamine. They show that scopolamine administered before encoding disrupts hippocampal theta phenomena and reduces memory performance, and that scopolamine administered after encoding but before retrieval impairs hippocampal theta phenomena (theta power, theta phase reset) and neural reinstatement but does not impair memory performance. This is an important study with exciting, novel results and translational implications. The manuscript is well written, the analyses are thorough and comprehensive, and the results seem robust.

      Strengths:

      - Very rare experimental design (intracranial neural recordings in humans coupled with pharmacological intervention);

      - Extensive analysis of different theta phenomena;

      - Well-established task with different conditions for familarity versus recollection;

      - Clear presentation of findings;

      - Translational implications for diseases with cholinergic dysfuction (e.g., AD);

      - Findings challenge existing memory models and the discussion presents interesting novel ideas.

    3. Reviewer #2 (Public review):

      Summary:

      In this study, performed in human patients, the authors aimed at dissecting out the role of cholinergic modulation in different types of memory (recollection-based vs familiarity and novelty-based) and during different memory phases (encoding and retrieval). Moreover, their goal was to obtain the electrophysiological signature of cholinergic modulation on network activity of the hippocampus and the entorhinal cortex.

      Strengths:

      Authors combined cognitive tasks and intracranial EEG recordings in neurosurgical epilepsy patients. The study confirms previous evidence regarding the deleterious effects of scopolamine, a muscarinic acetylcholine receptor antagonist, on memory performance when administered prior the encoding phase of the task. During both encoding and retrieval phases scopolamine disrupts the power of theta oscillations in terms of amplitude and phase synchronization. These results raise the question on the role of theta oscillations during retrieval and the meaning of scopolamine effect on retrieval-associated theta rhythm without cognitive changes. The authors clearly discussed this issue in the discussion session.

      A major point is the finding that scopolamine-mediated effect is selective for recollection-based memory and not for familiarity- and novelty-based memory.

      The methodology used is powerful and the data underwent a detailed and rigorous analysis.

    4. Author response:

      The following is the authors’ response to the original reviews.

      Public Reviews:

      Reviewer #1 (Public review):

      Summary:

      The authors report intracranial EEG findings from 12 epilepsy patients performing an associative recognition memory task under the influence of scopolamine. They show that scopolamine administered before encoding disrupts hippocampal theta phenomena and reduces memory performance, and that scopolamine administered after encoding but before retrieval impairs hippocampal theta phenomena (theta power, theta phase reset) and neural reinstatement but does not impair memory performance. This is an important study with exciting, novel results and translational implications. The manuscript is well-written, the analyses are thorough and comprehensive, and the results seem robust.

      Strengths:

      (1) Very rare experimental design (intracranial neural recordings in humans coupled with pharmacological intervention).

      (2) Extensive analysis of different theta phenomena.

      (3) Well-established task with different conditions for familiarity versus recollection.

      (4) Clear presentation of findings and excellent figures.

      (5) Translational implications for diseases with cholinergic dysfunction (e.g., AD).

      (6) Findings challenge existing memory models, and the discussion presents interesting novel ideas.

      Weaknesses:

      (1) One of the most important results is the lack of memory impairment when scopolamine is administered after encoding but before retrieval (scopolamine block 2). The effect goes in the same direction as for scopolamine during encoding (p = 0.15). Could it be that this null effect is simply due to reduced statistical power (12 subjects with only one block per subject, while there are two blocks per subject for the condition with scopolamine during encoding), which may become significant with more patients? Is there actually an interaction effect indicating that memory impairment is significantly stronger when scopolamine is applied before encoding (Figure 1d)? Similar questions apply to familiarity versus recollection (lines 78-80). This is a very critical point that could alter major conclusions from this study, so more discussion/analysis of these aspects is needed. If there are no interaction effects, then the statements in lines 84-86 (and elsewhere) should be toned down.

      The reviewer highlights important concerns regarding the statistical power of the behavioral effects. We address these concerns in the revised manuscript in two ways: (1) we provide a supplemental analysis using a matched number of blocks between the placebo and scopolamine conditions to avoid statistical bias related to differing trial counts, and (2) we include a supplemental figure illustrating paired comparisons between blocks.

      (2) Further, could it simply be that scopolamine hadn't reached its major impact during retrieval after administration in block 2? Figure 2e speaks in favor of this possibility. I believe this is a critical limitation of the experimental design that should be discussed.

      The reviewer raises an important methodological concern regarding the time required for scopolamine's effect to manifest and the subsequent impact on the study outcomes. Previous studies report that the average time to maximum serum concentration after intravenous (IV) scopolamine administration is approximately 5 minutes (Renner et al., 2005), with the corresponding clinical onset estimated at 10 minutes. In our study, the retrieval period in Block 2 commenced at 15 ± 0.2 post-injection across all subjects. Given this timing, there is sufficient reason to conclude that scopolamine had reached its major impact during the Block 2 retrieval phase. Furthermore, the observation of significant disruptions to theta oscillations during this same retrieval phase provides strong evidence that the drug was in full effect at that time.

      (3) It is not totally clear to me why slow theta was excluded from the reinstatement analysis. For example, despite an overall reduction in theta power, relative patterns may have been retained between encoding and recall. What are the results when using 1-128 Hz as input frequencies?

      Slow theta (2–4 Hz) was excluded from the reinstatement analysis to avoid potential confounding effects. Given the observed disruption to slow theta power following scopolamine administration, any subsequent changes in slow theta reinstatement would be causally ambiguous, potentially arising directly from the power effects. Therefore, we would be unable to determine whether changes in slow theta reinstatement were genuinely independent of changes in power.

      (4) In what way are the results affected by epileptic artifacts occurring during the task (in particular, IEDs)?

      To exclude abnormal events and interictal activity, a kurtosis threshold of 4 was applied to each trial, effectively filtering out segments exhibiting significant epileptic artifacts.

      Reviewer #2 (Public review):

      Summary:

      In this study, performed in human patients, the authors aimed at dissecting out the role of cholinergic modulation in different types of memory (recollection-based vs familiarity and novelty-based) and during different memory phases (encoding and retrieval). Moreover, their goal was to obtain the electrophysiological signature of cholinergic modulation on network activity of the hippocampus and the entorhinal cortex.

      Strengths:

      The authors combined cognitive tasks and intracranial EEG recordings in neurosurgical epilepsy patients. The study confirms previous evidence regarding the deleterious effects of scopolamine, a muscarinic acetylcholine receptor antagonist, on memory performance when administered prior to the encoding phase of the task. During both encoding and retrieval phases, scopolamine disrupts the power of theta oscillations in terms of amplitude and phase synchronization. These results raise the question of the role of theta oscillations during retrieval and the meaning of scopolamine's effect on retrieval-associated theta rhythm without cognitive changes. The authors clearly discussed this issue in the discussion session. A major point is the finding that the scopolamine-mediated effect is selective for recollection-based memory and not for familiarity- and novelty-based memory.

      The methodology used is powerful, and the data underwent a detailed and rigorous analysis.

      Weaknesses:

      A limited cohort of patients; the age of the patients is not specified in the table.

      To comply with human subject privacy protection policies, age was not reported; however, we did not find any significant effects of age on the behavioral or neural measures.

      Recommendations for the authors:

      Reviewer #1 (Recommendations for the authors):

      (1) Regarding dosage, did you take the patients' body weight into account? Do the effects hold when controlling for it?

      We controlled for participant weight, yet the observed effects were more strongly correlated with the absolute scopolamine dosage, irrespective of weight. This outcome indicates that scopolamine likely rapidly crosses the blood-brain barrier, producing swift effects that are not initially influenced by metabolic variability.

      (2) Line 96: Corrected for what kind of multiple comparisons?

      We apologize for this confusion. The statistical analysis presented in this line does not require multiple-comparison correction, and we will therefore remove the annotation.

      (3) Line 165: These are very interesting results. How do they relate to Rizzuto et al., NeuroImage, 2006?

      Our findings show that successful retrieval is tied to an encoding-retrieval phase match, which is a refinement and application of the Rizzuto et al. (2006) work. Rizzuto et al. showed that memory events are phase-locked; we show that maintaining a specific, matched phase relationship between encoding and retrieval events is critical for memory success, and that this process is dependent on the cholinergic system.

      Reviewer #2 (Recommendations for the authors):

      Figure 1b: It would be useful for clarity to have the cartoon of the treatment paradigm for the encoding phase (blocks 3 and 4).

      The treatment paradigm only involved a single intravenous (IV) injection of scopolamine (or saline, for the placebo condition). The injections were administered by the participant's attending nurse, with a board-certified anesthesiologist present at the time of injection and available throughout the experiment. These details are fully documented in the Methods section.

    1. eLife Assessment

      This valuable manuscript investigates the localisation of nutrient receptors in bloodstream stage trypanosomes, with implications for both nutrient uptake and immune evasion. Results after direct fixation of the cells in culture medium (as opposed to fixation after centrifugation) provide compelling evidence that the amounts of receptors on the surface of the cell, as opposed to the flagellar pocket, have previously been severely underestimated.

    2. Reviewer #1 (Public review):

      Summary:

      An interesting manuscript from the Carrington lab is presented investigating the behavior of single vs double GPI-anchored nutrient receptors in bloodstream form (BSF) T. brucei. These include the transferrin receptor (TfR), the HpHb receptor (HpHbR), and the factor H receptor (FHR). The central question is why these critical proteins are not targeted by host acquired immunity. It has generally been thought that they are sequestered in the flagellar pocket (FP), where they are subject to rapid endocytosis - any Ab:receptor complexes would be rapidly removed from the cell surface. This manuscript challenges that assumption by showing that these receptors can be found all over the outer cell body and flagella surfaces - if one looks in an appropriate manner (rapid direct fixation in culture media).

      Strengths and weaknesses:

      (1) The presence of a second ESAG6 gene in the BES7 expression site was noted in the previous review. This is now noted and discussed appropriately in the current version.

      (2) Surface binding studies: The ability of cells to bind tagged-Tf while in complete media was challenged and it was suggested that classic competition studies be performed to validate saturable ligand binding. This has been done now and the results confirm that this is so. A reasonable discussion of the results is presented.

      (3) Variable TfR expression in different BESs: The claim that specific ES environment is the dominant factor controlling TfR expression levels was challenged in that the presented results could be due to technical issues. RNA seq has now been performed confirming that the differences in TfR abundance is indeed directly related to mRNA levels

      (4) Surface immuno-localization of receptors: In regard to the novel immunofluorescence (direct fixation) methodology used to demonstrate TfR on the cell surface the authors were asked of they had attempted more traditional methods that involve centrifugation/washing. These data are now provided (Fig S5) and do indicate that centrifugation does reduce signal, likely due to shedding and/or internalization during the procedure. Nevertheless, significant signal is present after centrifugation leaving the issue of why others have never detected significant surface TfR.

      These responses address all the major concerns with the original submission and a greatly improved manuscript is now submitted.

    3. Reviewer #2 (Public review):

      The revised data support the conclusion that methodological differences can influence apparent receptor localization. However, key claims regarding functional surface engagement of TfR and hydrodynamic clearance remain based largely on indirect evidence and model-based interpretation. These conclusions should therefore be phrased more cautiously.

      I thank the authors for their careful rebuttal and the additional experiments included in the revised manuscript. The new fixation comparisons and transferrin competition assays substantially strengthen the technical basis of the study and address several of the original concerns.

      However, some conclusions remain more inferential than directly supported by the data. While the fixation and washing controls demonstrate that methodology influences apparent TfR localisation, they do not directly establish that previous protocols quantitatively redistribute surface TfR into the flagellar pocket. Statements implying such redistribution should therefore be phrased more cautiously.

      Similarly, the added transferrin binding controls argue against non-specific interactions, but functional engagement of surface-exposed TfR in intact bloodstream-form parasites remains supported mainly by indirect evidence. The proposed explanation involving rapid on/off rates and newly arriving receptors is plausible but should be more clearly identified as an inference.

    4. Author response:

      The following is the authors’ response to the original reviews.

      Public Reviews:

      Reviewer #1 (Public review):

      Summary:

      An interesting manuscript from the Carrington lab is presented investigating the behavior of single vs double GPI-anchored nutrient receptors in bloodstream form (BSF) T. brucei. These include the transferrin receptor (TfR), the HpHb receptor (HpHbR), and the factor H receptor (FHR). The central question is why these critical proteins are not targeted by host-acquired immunity. It has generally been thought that they are sequestered in the flagellar pocket (FP), where they are subject to rapid endocytosis - any Ab:receptor complexes would be rapidly removed from the cell surface. This manuscript challenges that assumption by showing that these receptors can be found all over the outer cell body and flagella surfaces, if one looks in an appropriate manner (rapid direct fixation in culture media).

      The main part of the manuscript focuses on TfR, typically a GPI1 heterodimer of very similar E6 (GPI anchored) and E7 (truncated, no GPI) subunits. These are expressed coordinately from 15 telomeric expression sites (BES), of which only one can be transcribed at a time. The authors identify a native E6:E7 pair in BES7 in which E7 is not truncated and therefore forms a GPI2 heterodimer. By in situ genetic manipulation, they generate two different sets of GPI1:GPI2 TfR combinations expressed from two different BESs (BES1 and BES7). Comparative analyses of these receptors form the bulk of the data.

      The main findings are:

      (1) Both GPI1 and GPI2 TfR can be found on the cell body/flagellar surface.

      (2) Both are functional for Tf binding and uptake.

      (3) GPI2 TfR is expressed at ~1.5x relative to GPI1 TfR

      (4) Ultimate TfR expression level (protein) is dependent on the BES from which it is expressed.

      Most of these results are quite reasonably explained in light of the hydrodynamic flow model of the Engstler lab and the GPI valence model of the Bangs lab. Additional experiments, again by rapid fixation, with HpHbR and FHR, show that these GPI1 receptors can also be seen on the cell surface, in contrast to published localizations.

      It is quite interesting that the authors have identified a native GPI2 TfR. However, essentially all of the data with GPI2 TfR are confirmatory for the prior, more detailed studies of Tiengwe et al. (2017). That said, the suggestion that GPI2 was the ancestral state makes good evolutionary sense, and begs the question of why trypanosomes prefer GPI1 TfR in 14 of 15 ESs (i.e., what is the selection pressure?)

      Strengths and weaknesses:

      (1) BES7 TfR subunit genes (BES7_Tb427v10): There are actually three (in order 5'3'): E7gpi, E6.1 and E6.2. E6.1 and E6.2 have a single nucleotide difference. This raises the issue of coordinate expression. If overall levels of E6 (2 genes) are not down-regulated to match E7 (1 gene), this will result in a 2x excess of E6 subunits. The most likely fate of these is the formation of non-functional GPI2 homodimers on the cell surface, as shown in Tiengwe et al. (2017), which will contribute to the elevated TfR expression seen in BES7.

      We would like to thank the reviewer for pointing out that there are two ESAG6 genes in BES7, we had relied on the publicly available annotation and should have known better.

      For transferrin expression levels, see the discussion in response to reviewer 1 point 3 below

      (2) Surface binding studies: This is the most puzzling aspect of the entire manuscript. That surface GPI2 TfR should be functional for Tf binding and uptake is not surprising, as this has already been shown by Tiengwe et al. (2017), but the methodology for this assay raises important questions. First, labeled Tf is added at 500 nM to live cells in complete media containing 2.5 uM unlabeled Tf - a 5x excess. It is difficult to see how significant binding of labeled TfR could occur in as little as 15 seconds under these conditions.

      The k<sub>on</sub> for transferrin is very rapid (BES1 TfR / bovine transferrin at pH7.4 = 4.5 x 10<sup>5</sup> M<sup>-1</sup>s<sup>-1</sup> (Trevor et al., 2019) and binding would occur to unoccupied receptors within 15 sec. The k<sub>off</sub> is also fast (BES1 TfR / bovine transferrin at pH7.4 = 3.6 x 10<sup>-2</sup> s<sup>-1</sup> (Trevor et al., 2019) and there would be exchange of transferrin within the time taken for endocytosis. These values are in vitro with purified proteins, the in vivo values may be affected by the VSG coat.

      The failure to bind canine transferrin (Supp. Figure 4B) acts as a control for specificity of the interaction.

      We have now performed a competition experiment as an additional control; cells in culture were supplemented with: A, 0.5 µM labelled transferrin; B, 0.5 µM labelled and 2.5 µM unlabelled transferrin; C, 0.5 µM labelled and 5 µM unlabelled transferrin, fixed after 60 s and visualised by fluorescence microscopy (Figure S4C). There was effective competition and greatly reduced binding of transferrin was seen in the presence of a 10-fold excess of unlabelled. We would like to thank the reviewer for suggesting this experiment.

      Second, Tiengwe et al. (2017) found that trypanosomes taken directly from culture could not bind labeled Tf in direct surface labelling experiments. To achieve binding, it was necessary to first culture cells in serum-free media for a sufficient time to allow new unligated TfR to be synthesized and transported to the surface. This result suggests that essentially all surface TfR is normally ligated and unavailable to the added probe.

      As part of the preliminary experiments for this paper we found that centrifugation followed by resuspension in either complete or serum free (but 1% BSA) medium resulted in a reduction is total cellular TfR and determined by western blotting. We have now included this experiment (Figure S4D). The inference from this experiment is that centrifugation and subsequently incubation will have an effect on receptor detection and endocytosis rates for a discreet time period.

      The amount of binding of labelled transferrin to cells in culture will depend on the specific activity of the labelled transferrin. This reasoning was behind the use of 0.5 µM labelled transferrin when roughly 1 in 6 molecules in the culture medium are labelled and there was only a small effect on the overall concentration of transferrin.

      Third, the authors have themselves argued previously, based on binding affinities, that all surface-exposed TfR is likely ligated in a natural setting (DOI:10.1002/bies.202400053). Could the observed binding actually be non-specific due to the high levels of fixative used?

      The absence of binding/uptake of canine transferrin argues against a non-specific interaction. In our previous publication, we did not pay enough attention to the on and off rates which allow for a degree of exchange and, here, TfR newly appearing on the cell surface has a 1 in 6 chance of binding a labelled transferrin.

      (3) Variable TfR expression in different BESs: It appears that native TfR is expressed at higher levels from BES7 compared to BES1, and even more so when compared to BES3. This raises the possibility that the anti-TfR used in these experiments has differential reactivity with the three sets of TfRs. The authors discount this possibility due to the overall high sequence similarities of E6s and E7s from the various ESs. However, their own analyses show that the BES1, BES3, and BES7 TfRs are relatively distal to each other in the phylogenetic trees, and this Reviewer strongly suspects that the apparent difference in expression is due to differential reactivity with the anti-TfR used in this work. In the grand scheme, this is a minor issue that does not impact the other major conclusions concerning TfR localization and function, nor the behavior of HpHbR and FHR. However, the authors make very strong conclusions about the role of BESs in TfR expression levels, even claiming that it is the 'dominant determinant' (line 189).

      This point is valid but exceptionally difficult to address at the protein level. As an orthogonal approach, we performed RNAseq analysis of the ‘wild type’ BES1, BES3, and BES7 cell lines to determine whether differences in receptor mRNA levels were consistent with the proposed difference in protein levels (Table S1). The analysis showed total ESAG6/7 mRNA levels to vary in a similar manner to the protein estimates with BES3 < BES1 < BES7 providing support for the differences in protein levels.

      The strongest evidence for the expression site determining the TfR level is the comparison of the cell lines in which the VSG were exchanged. This had no effect on TfR levels and so there is no evidence that the identity of the VSG alters TfR expression.

      (4) Surface immuno-localization of receptors: These experiments are compelling and useful to the field. To explain the difference with essentially all prior studies, the authors suggest that typical fixation procedures allow for clearance of receptor:ligand complexes by hydrodynamic flow due to extended manipulation prior to fixation (washing steps). Despite the fact that these protocols typically involve ice-cold physiological buffers that minimize membrane mobility, this is a reasonable possibility. Have the authors challenged their hypothesis by testing more typical protocols themselves? Other contributing factors that could play a role are the use of deconvolution, which tends to minimize weak signals, and also the fact that investigators tend to discount weak surface signals as background relative to stronger internal signals.

      We have added preliminary experiments that compared fixation protocols in two parts. First the effect on TfR levels of washing and resuspending cells discussed above (Figure S4D), and second how different fixation protocols alter apparent TfR immunolocalisation (Supp Figure S5A-B). The comparison shows that both the absence of glutaraldeyde and the use of washing alters the outcome.

      (5) Shedding: A central aspect of the GPI valence model (Schwartz et al., 2005, Tiengwe et al., 2017) is that GPI1 reporters that reach the cell body surface are shed into the media because a single dimyristoylglycerol-containing GPI anchor does not stably associate with biological membranes. As the authors point out, this is a major factor contributing to higher steady-state levels of cell-associated GPI2 TfR relative to GPI1 TfR. Those studies also found that the size/complexity of the attached protein correlated inversely with shedding, suggesting exit from the flagellar pocket as a restricting factor in cell body surface localization. The amount of newly synthesized TfR shed into the media was ~5%, indicating that very little actually exits the FP to the outer surface. In this regard, is it possible to know the overall ratio of cell surface:FP:endosomal localized receptors? Could these data not be 'harvested' from the 3D structural illumination imaging?

      A ratio could be determined but we did not do this as it would only be valid if the antibody has equal access to the internal TfR in a diluted VSG environment and the external VSG embedded in a densely packed and cross-linked VSG layer As such, we would have no confidence in the accuracy of any estimate.

      Reviewer #2 (Public review):

      The work has significant implications for understanding immune evasion and nutrient uptake mechanisms in trypanosomes.

      While the experimental rigor is commendable, revisions are needed to clarify methodological limitations and to broaden the discussion of functional consequences.

      The authors argue that prior studies missed surface-localized TfR due to harsh washing/fixation (e.g., methanol). While this is plausible, additional evidence would strengthen the claim.

      Preliminary experiments that compared fixation protocols are now included to show that method affects outcome.

      It remains unclear how centrifugation steps of various lengths (as in previous publications) can equally and quantitatively redistribute TfR into the flagellar pocket. If this were the case, it should be straightforward for the authors to test this experimentally.

      Not aware of previous studies that demonstrate equal and quantitative redistribution to the flagellar pocket. In previous reports, there is variation in cell surface/flagellar pocket localisation depending on expression levels, for example (Mussmann et al., 2003) (Mussmann et al., 2004), it’s worth noting that the increase in TfR expression in these papers is similar to the difference in the cell lines used here. In addition, most report the presence of TfR in endosomal compartments. In the experiments here, there are cells where the majority of signal from labelled transferrin is present in the flagellar pocket and the argument is that this is a stage of a continuous process in which the receptor picks up a transferrin on the cell surface and is swept towards the pocket.

      If TfR is distributed over the cell surface, live-cell imaging with fluorescent transferrin should be performed as a control. Modern detection limits now reach the singlemolecule level, and transient immobilization of live trypanosomes has been established, which would exclude hydrodynamic surface clearance as a confounding factor.

      This is non-trivial and is a longer-term aim. The immobilisation involves significant manipulation of the cells prior to restraining.

      In most images, TfR is not evenly distributed on the surface but rather appears punctate. Could this reflect localization to membrane domains? Immuno-EM with high-pressure frozen parasites could resolve this question and is relatively straightforward.

      There is a non-uniform appearance in the super-resolution images for both TfR and FHR. We cannot distinguish whether this represents random variation in receptor density over the cell surface or results from a biological phenomenon. Whatever the cause, the experiments showed unambiguous cell surface localisation.

      The authors might consider discussing whether differences in parasite life cycle stages (procyclic versus bloodstream forms) or culture conditions (e.g., cell density) affect localization. The developmentally regulated retention of GPI-anchored procyclin in the flagellar pocket might be worth mentioning.

      The aim of this paper was to determine the localisation of receptors in proliferating bloodstream form trypanosomes in culture. TfR and HpHbR are not expressed in insect stages in culture. FHR is expressed in insect stages and is present all over the cell surface (Macleod et al., 2020). A procyclin-based reporter was distributed over the whole cell surface in one report (Schwartz et al. 2005). In other reports, the retention of procyclin in the flagellar pocket of proliferating bloodstream forms is probably dependent on structure/sequence as other single GPI-anchored proteins, such as FHR (Macleod et al., 2020) and GPI-anchored sfGFP (Martos-Esteban et al., 2022) can access the surface.

      References:

      MacGregor, P., Gonzalez-Munoz, A. L., Jobe, F., Taylor, M. C., Rust, S., Sandercock, A. M., Macleod, O. J. S., Van Bocxlaer, K., Francisco, A. F., D’Hooge, F., Tiberghien, A., Barry, C. S., Howard, P., Higgins, M. K., Vaughan, T. J., Minter, R., & Carrington, M. (2019). A single dose of antibody-drug conjugate cures a stage 1 model of African trypanosomiasis. PLoS Neglected Tropical Diseases, 13(5), e0007373. https://doi.org/10.1371/journal.pntd.0007373

      Macleod, O. J. S., Bart, J.-M., MacGregor, P., Peacock, L., Savill, N. J., Hester, S., Ravel, S., Sunter, J. D., Trevor, C., Rust, S., Vaughan, T. J., Minter, R., Mohammed, S., Gibson, W., Taylor, M. C., Higgins, M. K., & Carrington, M. (2020). A receptor for the complement regulator factor H increases transmission of trypanosomes to tsetse flies. Nature Communications, 11(1), 1326. https://doi.org/10.1038/s41467-020-15125-y

      Martos-Esteban, A., Macleod, O. J. S., Maudlin, I., Kalogeropoulos, K., Jürgensen, J. A., Carrington, M., & Laustsen, A. H. (2022). Black-necked spitting cobra (Naja nigricollis) phospholipases A2 may cause Trypanosoma brucei death by blocking endocytosis through the flagellar pocket. Scientific Reports, 12(1), 6394. https://doi.org/10.1038/s41598-02210091-5

      Mussmann, R., Engstler, M., Gerrits, H., Kieft, R., Toaldo, C. B., Onderwater, J., Koerten, H., van Luenen, H. G. A. M., & Borst, P. (2004). Factors affecting the level and localization of the transferrin receptor in Trypanosoma brucei. The Journal of Biological Chemistry, 279(39), 40690–40698. https://doi.org/10.1074/jbc.M404697200

      Mussmann, R., Janssen, H., Calafat, J., Engstler, M., Ansorge, I., Clayton, C., & Borst, P. (2003). The expression level determines the surface distribution of the transferrin receptor in Trypanosoma brucei. Molecular Microbiology, 47(1), 23–35. https://doi.org/10.1046/j.13652958.2003.03245.x

      Schwartz, K. J., Peck, R. F., Tazeh, N. N., & Bangs, J. D. (2005). GPI valence and the fate of secretory membrane proteins in African trypanosomes. Journal of Cell Science, 118(Pt 23), 5499–5511. https://doi.org/10.1242/jcs.02667

      Trevor, C. E., Gonzalez-Munoz, A. L., Macleod, O. J. S., Woodcock, P. G., Rust, S., Vaughan, T. J., Garman, E. F., Minter, R., Carrington, M., & Higgins, M. K. (2019). Structure of the trypanosome transferrin receptor reveals mechanisms of ligand recognition and immune evasion. Nature Microbiology, 4(12), 2074–2081. https://doi.org/10.1038/s41564-019-0589-0

      Recommendations for the authors:

      Reviewer #1 (Recommendations for the authors):

      Major Recommendations:

      (1) 2 E6 gene in BES7s: This does not affect the overall conclusions, but the text should be modified to reflect the existence of the second gene, and to discuss the ramifications.

      This has been corrected

      (2) Surface binding studies: To clarify this issue, two experimental approaches are strongly recommended. First: additional excess unlabelled Tf should be added. If binding is truly receptor-mediated, it must by definition be saturable at some experimentally achievable level. Second: TfR expression should be abrogated by RNAi silencing to show that binding is TfR-dependent. Without some validation of specific binding by one or both of these approaches, these counter-intuitive results must be questioned.

      The excess unlabelled transferrin experiment is now included (we would like to thank the reviewer for this suggestion). The absence of binding of canine transferrin provides strong evidence for the specificity.

      (3) Variable TfR expression in different BESs: To make such claims, quantitative RTPCR should be performed with conserved primers to assess the actual relative expression at the transcriptional level. Absent this, the claims should be eliminated, or at the very least greatly tempered.

      This has been done using an RNAseq analysis.

      (4) Surface immuno-localization of receptors: An example of discounting weak signals as background can be seen in Figure 8 of Duncan et al. (2024). It has also been shown that at least one other GPI1 reporter (procyclin) is readily detected on the outer cell surface under ectopic expression in BSF trypanosomes (Schwartz et al., 2005) using typical fixation procedures. This could be cited, and the authors could discuss the fact that procyclin is not a receptor and may not be susceptible to hydrodynamic drag.

      Yes

      Minor issues:

      (1) Fully appreciating the data presented requires an understanding of the hydrodynamic flow and GPI valence models of the Engstler and Bangs labs, respectively. For the uninitiated,d it might perhaps be useful to include brief summaries of each in the Introduction.

      Added to the introduction

      (2) Lines 110-112: ISG65 and ISG75 both have strong localizations in endosomal compartments. This should be noted with citation of any of the work from the Field lab.

      Added

      (3) Lines 121-132: This passage presents the role of GPI anchors (1 vs 2) in a rather digital manner (in or out). Schwartz et al (2005) present a much more nuanced view of what is likely taking place. This is one reason summaries of hydrodynamic flow and GPI valence would be helpful.

      Modified

      (4) Lines 182-184: The increased size of GPI-anchored E7 is in part due to the presence of the GPI itself, as the authors state, but there are also 24 additional amino acid residues in this protein that contribute.

      Modified

      (5) Lines 212-214: Do p>0.95 and p>0.99 indicate statistical significance? This must be a typo.

      Thank you, corrected

      (6) Lines 218-219: The better references documenting GPI number in regard to turnover/shedding are Schwartz et al. 2005 and Tiengwe et al. 2017.

      Changed

      (7) Line 241 and Figures 3, 4, and 6: The transverse sections add little to the presentation. That there is signal variation in all dimensions is readily apparent from the images themselves, and similar profiles would be obtained regardless of the transect. Was there some process/rationale in the selection of the individual transects intended to make a broader point? If so, a description of the process should be provided.

      The point was to show that the signal had a pattern consistent with plasma membrane (two distal peaks) as opposed to cytoplasm (single central peak). As such, we think it is important.

      (8) Lines 582-596: Methodology for quantitation of cellular fluorescent signals should be provided.

      Has been expanded

      Reviewer #2 (Recommendations for the authors):

      (1) As a less critical but still useful control, antibody accessibility assays on live versus fixed parasites could test whether VSG coats limit detection.

      This could only be quantified by using a range of monoclonal antibodies which are not available.

      (2) The rapid transferrin uptake (15-60 seconds) could reflect fast endocytic recycling rather than stable surface residency. A pulse-chase experiment tracking receptor movement would clarify this (though I acknowledge that this is technically challenging).

      We agree that endocytic recycling is probably the main source of unoccupied TfR on the cell surface. It is hard to see how the pulse chase experiment could be performed without centrifugation which will affect the outcome – see above.

      (3) Statistical and quantitative reporting

      Added as Table S2- S4

      (4) Report confidence intervals (e.g., for fluorescence intensity comparisons in Figure 3B) to contextualize claims of "no significant difference."

      We do not claim ‘no significant difference’ and the SD overlap due to a high level of variation in the population

      (5) Specify the number of biological replicates and cells analyzed per condition in the figure legends.

      Added

      (6) The study notes that surface-exposed receptors avoid antibody detection, but does not explore how.

      We don’t claim that receptors avoid detection and have published evidence to the contrary. The cell has evolved mechanisms to reduce/minimise the effect of antibody binding.

      (7) Comparing antibody binding to TfR in VSG221 versus VSG224 coats.

      This is already present in Figure 3D

      (8) Testing whether receptor shedding or conformational masking contributes to immune evasion.

      A lifetime’s work

      (9) Evolutionary trade-offs: Discuss why T. brucei maintains ~15 TfR variants if the GPI-anchor number has minimal impact on function (Figure 3).

      The possible reason for the evolution of ~15 TfR variants was discussed in a previous publication.

      (10) How do their findings align with recent studies on ISG75 surface exposure?

      If this refers to the finding that ISG75 is an Ig Fc receptor, this has been included

      (11) Add scale bars to 3D reconstructions (Figure 5).

      Added

      (12) Include a schematic summarizing key findings in the main text.

      Chosen not to do

      (13) Explicitly state where raw microscopy images, flow cytometry data, and analysis scripts are deposited.

      Microscope Images have deposited in Bioimage Archive repository at EMBL/EBI No flow cytometry used

      (14) Correct inconsistent GPI-anchor terminology (e.g., "glycosylphosphoinositol" to "glycosylphosphatidylinositol").

      Our typo, corrected

      (15) Clarify ambiguous phrases (e.g., "subtle mechanisms" in the Discussion).

      Corrected

    1. eLife Assessment

      This fundamental study measures the functional specialization of distinct subregions within the mouse posterior parietal cortex (PPC) using mesoscopic two-photon calcium imaging during visual discrimination and choice history-dependent tasks. It presents compelling evidence supporting the existence of functional specialized subregions within the PPC. The work will be of interest to system and computational neuroscientists interested in decision-making, working memory, and multisensory integration.

    2. Reviewer #1 (Public review):

      Summary:

      This study examined the functional organization of the mouse posterior parietal cortex (PPC) using meso-scale two-photon calcium imaging during visually-guided and history-guided tasks. The researchers found distinct functional modules within the medial PPC: area A, which integrates somatosensory and choice information, and area AM, which integrates visual and choice information. Area A also showed a robust representation of choice history and posture. The study further revealed distinct patterns of inter-area correlations for A and AM, suggesting different roles in cortical communication. These findings shed light on the functional architecture of the mouse PPC and its involvement in various sensorimotor and cognitive functions.

      Strengths:

      Overall, I find this manuscript excellent. It is very clearly written and built up logically. The subject is important, and the data supports the conclusions without overstating implications. Where the manuscript shines the most is the exceptionally thorough analysis of the data. The authors set a high bar for identifying the boundaries of the PPC subareas, where they combine both somatosensory and visual intrinsic imaging. There are many things to compliment the authors on, but one thing that should be applauded in particular is the analysis of the body movements of the mice in the tube. Anyone working with head-fixed mice knows that mice don't sit still but that almost invariable remains unanalyzed. Here the authors show that this indeed explained some of the variance in the data.

      Comments on revisions:

      I only had minor comments on the first version of the manuscript and these concerns were fully addressed after revision.

    3. Reviewer #2 (Public review):

      Summary:

      The posterior parietal cortex (PPC) has been identified as an integrator of multiple sensory streams and guides decision making. Hira et al observe that dissection of the functional specialization of PPC subregions requires simultaneous measurement of neuronal activity throughout these areas. To this end, they use widefield calcium imaging to capture the activity of thousands of neurons across the PPC and surrounding areas. They begin by delineating the boundaries between the primary sensory and higher visual areas using intrinsic imaging and validate their mapping using calcium imaging. They then conduct imaging during a visually guided task to identify neurons that respond selectively to visual stimuli or choice. They find that vision and choice neurons intermingle primarily in the anterior medial (AM) area, and that AM uniquely encodes information regarding both the visual stimulus and the previous choice, positioning AM as the main site of integration of behavioral and visual information for this task.

      Strengths:

      There is an enormous amount of data and results reveal very interesting relationships between stimulus and choice coding across areas and how network dynamics relate to task coding.

      Weaknesses:

      The enormity of the data and the complexity of the analysis makes the manuscript hard to follow. Sometimes it reads like a laundry list of results as opposed a cohesive story.

      Comments on revisions:

      The authors have addressed our concerns.

    4. Reviewer #3 (Public review):

      Summary:

      This work from Hira et al leverages mesoscopic 2-photon imaging to study large neural populations in different higher visual areas, in particular areas A and AM of the parietal cortex. The focus of the study is to obtain a better understanding of the representation of different task-related parameters, such as choice formation and short-term history, as well as visual responses in large neural populations across different cortical regions to obtain a better understanding of the functional specialization of neural populations in each region as well as the interaction of neural populations across regions. The authors image a large number of neurons in animals that either perform a visual discrimination or a history-dependent task to test how task demands affect neural responses and population dynamics. Furthermore, by including a behavioral perturbation of animal posture they aim to dissociate the neural representation of history signals from body posture. Lastly, they relate their functional findings to anatomical data from the Allen connectivity atlas and show a strong relation of functional correlations on anatomical connectivity patterns.

      Strengths:

      Overall, the study is very well done and tackles a problem that should be of high interest to the field by aiming to obtain a better understanding of the function and spatial structure of different regions in the parietal cortex. The experimental approach and analyses are sound and of high quality and the main conclusions are well supported by the results. Aside from the detailed analyses, a particular strength is the additional experimental perturbation of posture to isolate history-related activity which supports the conclusion that both posture and history signals are represented in different neurons within the same region.

      Weaknesses:

      The work does not focus on functional overlap at the single-cell level but on the spatial distribution of functional classes across areas. A minor weakness is therefore that it does not explicitly address how the finding of functional clusters relate to established notions of mixed selectivity within PPC.

    5. Author response:

      The following is the authors’ response to the original reviews.

      We sincerely appreciate your constructive feedback. Based on the comments from the three reviewers, we were able to substantially improve the manuscript. Below, we provide our point-by-point responses.

      Public Reviews:

      Reviewer #1 (Public review):

      Summary:

      This study examined the functional organization of the mouse posterior parietal cortex (PPC) using meso-scale two-photon calcium imaging during visually-guided and history-guided tasks. The researchers found distinct functional modules within the medial PPC: area A, which integrates somatosensory and choice information, and area AM, which integrates visual and choice information. Area A also showed a robust representation of choice history and posture. The study further revealed distinct patterns of inter-area correlations for A and AM, suggesting different roles in cortical communication. These findings shed light on the functional architecture of the mouse PPC and its involvement in various sensorimotor and cognitive functions.

      Strengths:

      Overall, I find this manuscript excellent. It is very clearly written and built up logically. The subject is important, and the data supports the conclusions without overstating implications. Where the manuscript shines the most is the exceptionally thorough analysis of the data. The authors set a high bar for identifying the boundaries of the PPC subareas, where they combine both somatosensory and visual intrinsic imaging. There are many things to compliment the authors on, but one thing that should be applauded in particular is the analysis of the body movements of the mice in the tube. Anyone working with head-fixed mice knows that mice don't sit still but that almost invariable remains unanalyzed. Here the authors show that this indeed explained some of the variance in the data.

      Weaknesses:

      I see no major weaknesses and I only have minor comments.

      Reviewer #2 (Public review):

      Summary:

      The posterior parietal cortex (PPC) has been identified as an integrator of multiple sensory streams and guides decision-making. Hira et al observe that dissection of the functional specialization of PPC subregions requires simultaneous measurement of neuronal activity throughout these areas. To this end, they use wide-field calcium imaging to capture the activity of thousands of neurons across the PPC and surrounding areas. They begin by delineating the boundaries between the primary sensory and higher visual areas using intrinsic imaging and validate their mapping using calcium imaging. They then conduct imaging during a visually guided task to identify neurons that respond selectively to visual stimuli or choices. They find that vision and choice neurons intermingle primarily in the anterior medial (AM) area, and that AM uniquely encodes information regarding both the visual stimulus and the previous choice, positioning AM as the main site of integration of behavioral and visual information for this task.

      Strengths:

      There is an enormous amount of data and results reveal very interesting relationships between stimulus and choice coding across areas and how network dynamics relate to task coding.

      Weaknesses:

      The enormity of the data and the complexity of the analysis make the manuscript hard to follow. Sometimes it reads like a laundry list of results as opposed to a cohesive story.

      Reviewer #3 (Public review):

      Summary: This work from Hira et al leverages mesoscopic 2-photon imaging to study large neural populations in different higher visual areas, in particular areas A and AM of the parietal cortex. The focus of the study is to obtain a better understanding of the representation of different task-related parameters, such as choice formation and short-term history, as well as visual responses in large neural populations across different cortical regions to obtain a better understanding of the functional specialization of neural populations in each region as well as the interaction of neural populations across regions. The authors image a large number of neurons in animals that either perform visual discrimination or a history-dependent task to test how task demands affect neural responses and population dynamics. Furthermore, by including a behavioral perturbation of animal posture they aim to dissociate the neural representation of history signals from body posture. Lastly, they relate their functional findings to anatomical data from the Allen connectivity atlas and show a strong relation between functional correlations on anatomical connectivity patterns.

      Strengths:

      Overall, the study is very well done and tackles a problem that should be of high interest to the field by aiming to obtain a better understanding of the function and spatial structure of different regions in the parietal cortex. The experimental approach and analyses are sound and of high quality and the main conclusions are well supported by the results. Aside from the detailed analyses, a particular strength is the additional experimental perturbation of posture to isolate history-related activity which supports the conclusion that both posture and history signals are represented in different neurons within the same region. Weaknesses: The main point that I found hard to understand was the fairly strong language on functional clusters of neurons while also stating that neurons encoded combinations of different types of information and leveraging the encoding model to dissociate these contributions. Do the authors find mixed selectivity or rather functional segregation of neural tuning in their data? More details on this and some other points are below.

      We thank the three reviewers for their accurate and expert evaluations.

      Recommendations for the authors:

      Reviewer #1 (Recommendations for the authors):

      (1) It wasn't clear to me why the authors focused on areas A and AM, but not RL. After all, at the beginning of the results, the authors ask: "PPC has been reported to have functions including visually guided decision-making and working memory. Do these functions differ among RL, A, and AM?".

      Thank you for the comment. The manuscript first characterizes AM as a region involved in visually guided decision-making and A as a region related to history and/or working memory. Subsequently, when discussing correlation structure, we stated the following:

      “In particular, based on the critical functional differences between A and AM that we found, A and AM may belong to distinct cortical networks that consist of different sets of densely interacting cortical areas.”

      Thus, the logical flow of our analysis is to first reveal the functional contrast between A and AM through comparative functional analyses across RL, A, and AM, and then to focus on this contrast. We speculate that RL may exhibit more distinctive functional properties in tasks that rely on whisker-based processing or related modalities. We have therefore revised the text as described below to avoid the impression that the manuscript places disproportionate emphasis on RL.

      Line 137: “PPC has been reported to have functions including visually guided decisionmaking and working memory. Do these functions differ among A, AM, and RL?”

      (2) Figures 2 E, F, and Figure 3A, could the authors indicate the trial structure better on these plots?

      Thank you for the comment. We have added explanations of the bar meanings to the figure legends.

      Figure 2:

      “(E) Representative vision neurons (ROI 1-4 in I). The red bars indicate sampling periods during video presentation, and the brown bars indicate sampling periods without video stimulation. Vertical black lines mark the onset of the sampling period. F. Representative choice neuron (ROI 5-8 in I) and a non-selective neuron (ROI 9). Light blue lines indicate the response periods in trials with left choices, and purple lines indicate the response periods in trials with right choices. Vertical black lines mark the onset of the response period.”

      Figure 3:

      “(A) The representative history neurons. Numbers correspond to that of panel B and C. Light blue lines indicate rewards delivered from the left lick port, and purple lines indicate rewards delivered from the right lick port. Vertical white lines mark the onset of the sampling period.”

      (3) There are several typos that need correcting. Also, small and big capital letters to demark the panel names in the legends have been mixed.

      Thank you for the comment. We have corrected the panel labels as described below.

      Figure 2 legend:

      “Representative choice neuron (ROI 5-8 in I) and a non-selective neuron (ROI 9)”

      Figure 3 legend:

      “..than the next choice. I. The decoding accuracy of the next choice …”

      Figure 3 legend:

      “Error bars, mean ± s.e.m. in I, 95% confidence interval in G. M, and O.”

      Supplementary Figure 6:

      “…neurons with rt ≥ 0.3 (blue) were shown. B. Trial-to-trial activity fluctuation … (rt ≥ 0.3, panel B) was color coded…”

      We thoroughly checked the manuscript for typographical errors and corrected the issues.

      (4) Many in the field still use the Paxinos nomenclature for PPC subfields, could the authors write something short about how these two nomenclatures correspond?

      We have described the relationship between our area definitions and those of Paxinos in the main text as follows.

      Line 702: “In addition to our definition, previous studies have also defined posterior parietal cortex (PPC) to include the higher visual areas A, AM, and RL (Glickfeld and Olsen, 2017; Wang et al., 2011). These areas partially overlap with the parietal association regions defined in the Paxinos atlas, including MPtA, LPtA, PtPD, and PtPR. For a detailed discussion of the correspondence and variability among these regional definitions, see Lyamzin and Benucci (2019).”

      (5) Analyzing choice history may be affected by the long fluorescence Ca transients and will depend on excellent event deconvolution. Could the authors show some more zoomed-in examples of how well their deconvolution works?

      We provide enlarged, trial-by-trial activity traces of the four example neurons shown in Figure 3A in Supplementary Figure 3G. In all neurons, multiple small calcium transients occur repeatedly throughout the delay period, which lasts longer than 10 s. If the sustained activity during the delay were simply due to a long decay time constant, one would expect a large calcium transient in the preceding trial that slowly decays over the delay period. However, such a pattern is not observed in the actual data. Also, since the decay time constant of GCaMP6s is on the order of ~1 s, signals persisting for ~10 s cannot be explained by slow decay alone.

      (6) The authors write: "the history neurons exhibited properties of working memory." However, note that this is not a working memory task since the mice don't need to keep evidence in memory, the direction to lick can be made at the very beginning of a trial.

      Behaviorally, demonstrating that an animal maintains working memory requires showing that its behavior changes based on retained information when new information is introduced, as in delayed match-to-sample tasks. In the present task, however, the correct action for the next trial is determined at the moment the action in the previous trial is completed, such that animals can simply switch to motor preparation at that point. Thus, from a strictly behavioral perspective, working memory is not required.

      On the other hand, during the inter-trial interval (ITI), information from the previous trial dominates over information from the upcoming trial (Fig. 3H), which is more consistent with retention of past information than with motor preparation. Moreover, trials in which neural activity maintained information about the previous trial’s action were associated with a higher probability of correct performance in the subsequent trial. In other words, retaining past information contributes to guiding correct behavior in the next trial.

      Based on these neural analyses, we interpret that mice retain information about their previous trial’s action history in working memory and use it to determine behavior in the subsequent trial. Accordingly, we consider ITI activity in PPC to reflect working memory rather than motor preparation. Nevertheless, we acknowledge that your concern is valid, and we have therefore revised the text as follows:

      Line 234: “These results suggest that the history neurons exhibited properties of working memory.”

      (7) In the section about the Choice History Task, the authors write: "Since the visual stimuli were randomly presented during the sampling period, the mice had to ignore the visual stimuli." Why continue to present the visual stimuli?

      Thank you for the suggestion. By designing the vision task and the history task to have identical structures, we can apply the same encoding and decoding models to both tasks, which facilitates direct comparison between them. This design makes it easier to examine how neuronal activity patterns change depending on task demands.

      Reviewer #2 (Recommendations for the authors):

      (1) I don't understand the logic of Figure S7 and the neuropil analysis in general. Neuropil activity is purported to represent input, so it seems unsurprising that nearby neurons would exhibit similar dynamics.

      Thank you for your comment. Your argument is correct, and it is not at all surprising that neuropil signals correlate with the activity of surrounding neurons. Here, we quantitatively examined the relationship between neuropil activity and the average activity of nearby neurons. In addition, in a separate analysis, we clarified the relationship between connectome information and neuropil activity. Taken together, these analyses reveal the relationship between connectome information and the local average of neuronal activity. We describe this point as follows:

      “Indeed, the trial-to-trial variation of a neuropil activity could be approximated by the average of 1,000–10,000 neurons within several hundred micrometers from the center (Figure S7).”

      Although we analyzed this phenomenon in the cases of areas A and AM, this finding should not be considered specific to A and AM but instead has broader, general significance. Accordingly, we added a new Results subsection and revised the manuscript as follows.

      Line 448: “Constraints and limits of anatomical connectivity on neuronal population activity Although we have so far focused on the differences between A and AM, our data provide broader insights into the relationship between anatomical connectivity and neuronal population activity. First, based on Figure S7 and the considerations above, anatomical input correlations strongly constrain the correlations between local averages of activity across thousands of neurons. We then asked whether this anatomical constraint extends beyond mean activity, and how anatomical input correlations relate to relationships between neuronal population activities (population vectors).

      The correlation between CC<sub>t</sub> and r<sub>anatomy</sub> was moderate (r = 0.60, Figure 6L). This moderate correlation did not change when the coupling neurons were eliminated (r = 0.61). Interestingly, the largest canonical component was the most unpredictable from the anatomical data (Figure 6M). Thus, while inter-area correlations based on the mean activity of neuronal populations are largely determined by anatomical input correlations, correlations between population vectors contain additional structure that cannot be captured by anatomical input correlations alone.

      One possible source of this additional structure is globally shared activity, which may reflect behavior, brain state, or levels of neuromodulators. To evaluate the contribution of global activity on the canonical correlation between areas, we first compared the canonical coefficient vectors (CCV). We found that the first CCV had a similar orientation, regardless of the paired areas (Figure6N). This indicates that the largest components of correlated activity in the CCA analysis are globally shared fluctuations. We also directly evaluated the correlated activity components across all 8 areas with generalized canonical correlation analysis. The first CCV also had a similar orientation to the first generalized canonical coefficient vector (GCCV) (Figure 6O). These results indicate that the largest canonical component reflects a global correlation across all cortical areas imaged. Such global correlations may be driven by factors beyond cortico-cortical or thalamo-cortical inputs, such as the animal’s behavioral state as we recently characterized (H. Imamura et al., 2025; F. Imamura et al., 2025). We also confirmed the robustness of these results by repeating analyses using only the 40% highly active neurons after denoising with non-negative deconvolution (36828 out of 91397 neurons; Figure S9).”

      (2) Furthermore, the neuropil signal likely contains signals from out-of-focus neurons that are presumably functioning similarly to the in-focus cells. Wouldn't the interesting question be to what extent the local neuropil signal in, for example, area A resembled that of neuronal activity in S1t?

      Thank you very much for your comment. We agree with your point. Based on the evaluation in Figure S7, the neuropil signal likely contains the average activity of several thousand local neurons, including out-of-focus contributions. The neuropil signal in area A may also partially reflect neuronal activity from the neighboring S1t area. In particular, neurons that show little correlation with the local population average (i.e., the neuropil signal) within the same area are sometimes referred to as “soloists” (M. Okun et al., 2015). If such soloist neurons were found to exhibit strong correlations with the neuropil signal of an adjacent area, this would be a highly interesting result. However, such an analysis would go beyond the scope of the present manuscript and would require a new line of discussion; therefore, we plan to address this issue in future work.

      (3) I generally found the final Results section (Relationship between mesoscale functional correlation and anatomical connections) to be hard to follow. The motivation for this analysis should be better explained.

      We fully incorporated your suggestion and rewrote the final section of the Results accordingly. Please refer to our responses to the two comments above.

      (4) The question of brain state/neuromodulation as a driver of the globally shared activity may be addressable by considering its correlation with pupillometry data.

      We fully agree with your suggestion. In our experiments, visual stimuli change continuously, and thus pupil diameter changes are most likely driven primarily by changes in visual input. Although state-dependent fluctuations of brain activity may also be present, they are likely masked by the larger effects induced by visual stimulation. Therefore, analyzing pupil-linked signals as a factor of globally shared activity would be more appropriately addressed in experiments without visual stimulation. We plan to investigate this issue in future studies. Here, we have added the following description regarding pupil dynamics and their associated relationships.

      Line 292: “We found that the neurons related to the tail and forepaws were similarly distributed around the parietal cortex including S1 and A, while the pupil-size related neurons were mapped around visual areas (Figure 4C). Changes in pupil diameter may influence neuronal activity through multiple mechanisms, including behavioral state or noradrenergic level [REF], nonlinear interactions with visual stimulation, and changes in the amount of light reaching the retina.”

      Minor issues

      (1) The authors deploy sophisticated mathematical techniques with essentially no explanation outside the Methods section. A brief introduction of jPCA and CCA in the main text would help the reader understand the value of these analyses.

      Thank you for the comment. We added the following explanation.

      Line 238: “In this task, left and right selection are alternated, so the activity of the history neuron is a sequence that repeats in two consecutive trials. We used jPCA<sup>49</sup> to visualize and quantify this activity pattern (Figure 3K). jPCA identifies low-dimensional projections of population activity that maximize rotational dynamics across time.”

      Line 374: “Next, to investigate r<sub>t</sub> of the population activity (r<sub>t_population</sub>), we first reduced the dimension of population activity in each area into 10 by using PCA (principal component analysis) (Figure S6B,C). Then, “fluctuation activity” was recalculated for each dimension and trial type, analogous to the single-neuron analysis described above, but here representing noise in population-level activation patterns. We applied CCA (canonical correlation analysis) to each pair of areas and obtained an average of 10 canonical correlations (CC<sub>t</sub>) as r<sub>t_population</sub>. CCA identifies pairs of linear combinations of population activity from two areas that maximize their correlation across trials, thereby capturing shared population-level fluctuations. The CC<sub>t</sub> structure between areas was similar across task types (Figure 5H) indicating that this structure reflects the underlying functional connectivity independent of the task. The CC<sub>t</sub> between A and S1t was the largest among all the pairs (Figure 5H), whereas when the CC<sub>t</sub> was averaged across all connections for each area, A and AM had the largest and second largest C<sub>t</sub>, respectively (Figure 5I). The dominance in CC<sub>t</sub> in A and AM disappeared when the neurons with r<sub>t_single</sub> >0.3 were removed. Notably, the CC<sub>t</sub> of AM and the other areas was uniform regardless of the paired areas across all 10 canonical components (Figure 5J). Thus, area AM is an integration hub of interareal communication, whereas A simply coupled with S1t, and such correlation structure at the population level critically depends on this subset of neurons.”

      (2) The manuscript contains numerous typos ("hoice"), spelling errors ("parameters", "costom"), abbreviations that are not defined (ex: RL/rostrolateral), and minor grammatical issues that should be addressed by a round of copy editing.

      We thank the reviewer for pointing this out. We have thoroughly corrected these typographical and grammatical errors, and have described the revisions in detail in our response to Reviewer 1, comment (3). In addition, we have clarified the abbreviations in the manuscript as follows.

      Line 94: “rostrolateral area (RL)”

      Figure 1 legend: “Abbreviations: RL, rostrolateral HVA; PM, posteromedial HVA; RSC, retrosplenial cortex.“

      (3) Figure 3K unlabeled axes.

      Thank you for the comment. We have added the axis labels.

      (4) Figure 3K caption, first "(right)" should be "(left)".

      Thank you very much for your careful attention to detail. We have made the requested correction.

      (5) Figure 6 is hard to read. Panel A is too small, and the interpretation of G is difficult.

      - For panel A, we added an enlarged view with images from a larger number of trials in Figure S7A.

      - G represents the connectivity matrix. The sources correspond to the injection sites, and the targets correspond to voxels in the cerebral cortex. Because the latter may not be immediately clear, we explicitly indicated in the figure that the targets are cortical voxels.

      (6) Figure S4C has a double compass.

      Thank you for the comment. We have revised the manuscript accordingly.

      Reviewer #3 (Recommendations for the authors):

      While I have some questions and additional suggestions to further improve the clarity of the manuscript, I already found it to be highly interesting and well done in its current form.

      Major points:

      (1) The t-SNE comes up rather abruptly and is not well-explained in the main text or the figure caption. It would be good to provide some more information on the rationale of this analysis and how to interpret it. In particular, I don't see clear clusters in Figure 2H although the description of the authors seems to indicate that they observe clear functional classes such as choice, stimulus, and history neurons. Similarly, in Figure 3B, I don't see a clear separation between history and choice neurons in the t-SNE map. The example cells in Figure 3A appear to be delayed or long-tailed choice neurons rather than a dedicated group of 'history neurons'. It would be helpful for the interpretation of the t-SNE plots to show different PSTHs for different regions of the t-SNE map to better illustrate what different regions within the t-SNE projection represent and what distinguishes these cells.

      Thank you for the comment. The absence of clearly defined clusters in the t-SNE map suggests that neuronal activity forms a continuum rather than discrete classes. Importantly, the purpose of the t-SNE map here is not to identify sharp clusters, but to demonstrate that the functional categorization provided by our encoding model broadly and comprehensively spans the major structures present in the unsupervised t-SNE map. We have revised the relevant text in the manuscript accordingly as follows.

      Line 158: “To examine whether the neuron groups labeled by this model broadly capture the diversity of neuronal activity, we performed unsupervised clustering of neuronal activity using t-SNE. The functional labels revealed by this encoding model were consistent with the t-SNE clusters, indicating the validity of the encoding model (Figure 2H; Figure S4B; materials and methods).”

      The issue regarding History neurons was also raised in Reviewer #1’s comment (5). We provide an enlarged view of Figure 3A in Figure S3A. Each History neuron exhibits multiple calcium transients repeatedly and asynchronously following the previous reward acquisition. Therefore, rather than being “choice neurons with a long tail,” these neurons are better interpreted as neurons whose activity is sustained during this delay period.

      (2) Although the authors mention that neurons represent a mixture of features, they then use the encoding model to isolate clusters, such as vision or choice neurons. In general, the language throughout the manuscript suggests that there are various clusters of functionally segregated neurons (vision, choice, history, or coupling neurons). However, it is not clear to me to what extent this is supported by the data. Couldn't a choice neuron also be a vision neuron if both variables make significant contributions to the model? Similarly, are 'history' and 'choice' separate labels from the encoding model, or could a cell be given multiple labels? If a cell could be given multiple labels how did the authors create the colored plots on the right-hand side of Figures 2H and 3B? The example history cells in Figure 3J also appear to be highly selective for the contralateral choice, so again this seems to argue against a clear separation of choice and history neurons.

      Each label is assigned based on whether the corresponding coefficient is significant in the encoding model, and therefore neurons that are both vision- and choice-selective do exist. The presence of mixed selectivity neurons in PPC is well established (e.g., MJ Goard et al., 2016 elife). In this manuscript, however, we focus not on functional overlap at the single neuron level, but on the spatial distribution of functional classes, and thus do not explicitly address mixed selectivity. Although the colors in Figure 2H and Figure 3B overlap, the underlying data for each are presented separately in Figure S4B and S4D, respectively. As shown there, each color generally occupies distinct regions in the t-SNE map.

      (3) The decoding analysis in Figure 3F also suggests that a potential reason why there are more choice history signals in areas S1 and A is that neural activity is simply larger rather than due to the activity of a dedicated group of history neurons. Are the authors interpreting this differently? Could the duration of stored choice information also be affected by the dynamics of the calcium indicator?

      Thank you for the comment. Simply having larger neural activity in S1t or A would not result in calcium transients with a ~1-s time constant persisting throughout a delay period lasting up to 10 seconds. As also noted in comment (1), History neurons exhibit sustained and repeated calcium transients, and therefore their activity cannot be explained merely by elevated neural activity levels. One could argue that all cortical areas carry history-related information but that the signal-to-noise ratio is higher in S1t or A, which might make such signals more detectable there. If this were the case, however, differences across areas in all forms of selectivity should similarly depend on signal-to-noise ratio. This is not what we observe in our data.

      (4) I'm confused as to why the decoding accuracy is so high for areas A and S1t at time -3 relative to the choice in Figure 3F. Shouldn't this be the same as predicting the next choice in Figure 3H? Why is the decoding accuracy lower in this case?

      Thank you for the comment. The analysis shown in Figure 3F includes only trials in which the choice was correct. This is the reason why the decoding performance in Figure 3H is lower. We have added this clarification to the main text.

      Figure 3F: “Decoding accuracy of choice, outcome, and visual stimuli by the activity of 20 neurons from each area using only correct trials, before and after the choice onset, reward delivery, and the end of the visual stimuli, respectively. Line colors corresponded to the areas shown in panel G.”

      (5) In general, the text is not very detailed about the statistics. While test scores and p-values are mentioned, it would be good to also state what is actually compared and what the n is (e.g. how many neurons, neuron pairs, areas, sessions, or animals) for each case. How do the authors account for the nested experiment design where many neurons are coming from a low number of animals?

      Thank you for the comment. In our decoding analyses, we generally treat the number of animals as the independent variable. In contrast, for the encoding model analyses, we treat the number of neurons as the independent variable. As you correctly pointed out, because we recorded activity from a large number of neurons, statistical tests that treat individual neurons as independent samples can readily yield significant p-values even with a small number of animals. We have therefore confirmed that our conclusions are not driven by a large effect from a single animal. When making qualitative claims, we rely not only on statistical significance (p-values) but also require clear differences in effect size. We have added the following clarification to the Statistics section accordingly.

      Line 1049: ”For the decoding analyses, the number of animals was treated as the independent variable, whereas for the encoding model analyses, the number of neurons was treated as the independent variable. To ensure that the results were not driven by a single animal, we repeated the statistical tests while systematically excluding data from one animal at a time and confirmed that statistical significance was preserved in all cases. Furthermore, qualitative interpretations were made only when differences in effect size were clearly observed.”

      (6) How was the grouping in Figure 2O done? Specifically, how were the thresholds for the dashed lines selected to separate PM and V1 from AM and RL as association areas? It seems to me like this grouping was done rather arbitrarily as the difference in choice decoding accuracy is not particularly large between these areas.

      This line does not have a specific quantitative basis, but we consider it useful as an illustrative aid. We have added this clarification to the figure legend.

      Figure 2O: “Decoding accuracies of time in video presentation and choice direction indicate that AM would be the best position for associating these two signals. The background color and dashed lines are provided as visual aids for illustrative purposes.”

      (7) The fact that neurons with high rt_single tend to share the same function might also indicate the approach is insufficient to remove all effects of tuning to trial types from the neural data. Since the authors subtract the average of each trial type, the average trial-type related information is removed but type-specific variations that are not equally presented in the average might remain. For choice neurons for example, attentive vs in-attentive choices could be represented differently and thus remain in the data since the average would be a mixture of both. The same goes for other factors that would drive a particular modulation in the choice - or stimulus - related part of the trial which could still tie these neurons together. One way to circumvent this concern could be to first compute the mean activity for all time points in each trial and then compute the trial-to-trial variability across all trials of the same type. Alternatively, I would be curious how the results play out when using data when the animal is not actively performing the task to compute rt_single.

      Thank you for the comment. The concern raised by the reviewer applies to all noise-correlation analyses and highlights an important limitation of this approach, namely that factors other than the observed variables are treated as noise. By subtracting the trial-averaged activity, information related to sensory input and the direction of the first lick at choice can be removed. However, other factors cannot be eliminated if they are not observed. For example, if right hindlimb movements tend to occur only in trials with visual stimulation combined with left choice, such effects cannot be removed because they are not measured. The same issue remains even when restricting the analysis to a single trial type. Based on these considerations, we have added the following text to the manuscript.

      Line 932: “Correlation of trial-to-trial variance of activity between a pair of single neurons was defined as r<sub>t_single</sub>. To calculate r<sub>t_single</sub>, we averaged the activity of individual neurons over the sampling period, and the average across each trial type was subtracted from this value. The trial types consisted of four sets of pairs of stimuli and responses, that is, the video stimulation and left choice, the video stimulation and right choice, the black screen and left choice, and the black screen and right choice. By this operation, we extracted the fluctuating components of single-neuron activity that are independent of the trial types. Although the finding that neurons with high r<sub>t_single</sub> tend to share the functional properties we propose is not a trivial consequence of the analysis. At the same time, it remains possible that high r<sub>t_single</sub> reflects the degree to which neurons share unobserved features, and that such features are correlated with our functional classification. Thus, while this analysis suggests that correlated fluctuations across cortical areas may contribute to the determination of functional types, establishing an exclusive conclusion will require more fine-grained behavioral measurements, tighter control of internal states, and causal identification through targeted interventions.”

      Minor points:

      (1) Why did the authors use the activity of 50 neurons for the decoder analysis in Figure 2K? Didn't they have many more neurons available? How were these selected?

      We found that the conclusions were identical when using datasets consisting of either 50 neurons or 20 neurons across all analyses. Because the total number of recorded PM neurons did not reach 100 in at least one mouse, we standardized the analyses to 50 neurons in order to match the number of neurons across all cortical areas and animals.

      (2) The authors mention that some PPC neurons showed complex dynamics rather than encoding a specific feature such as visual or choice information but do not mention actual numbers on this point. It would be good to quantify to what extent neurons in different regions represent such mixed selectivity and whether there are clear differences in selectivity. This would also be interesting to discuss in context to earlier work on mixed selectivity in the parietal cortex, such as Raposo et al 2015.

      Thank you for the comment. Your point is entirely valid. However, as explained in our response to your major comment, our analyses focus not on how individual neurons are classified, but rather on the spatial distribution of these functional categories.

      (3) I have a hard time understanding what the length of the bars in the right panel of Figure 2k indicates. Does this plot show more than the decoder accuracy before and after the choice? Is the bar length related to the standard deviation? The same question for the visualization in panel 2n. It looks nice but I'm confused about what it shows exactly.

      These bars represent confidence intervals. Although this is stated at the end of the Figure 2 legend, we agree that it may not be sufficiently clear, and we have therefore added this information to the Statistics section.

      Line 1046: “In Figure 2K and N, and Figure 3G, L, M, and O, the bars indicate the 95% confidence intervals. All other bars denote s.e.m., unless otherwise noted.”

      (4) Is Figure 3D showing the same association index as in Figure 2j, thus showing the same result as in the vision task or is this meant to show something new? It was not clear to me from the wording, so it would be good to clarify.

      You are correct that the magenta trace in Fig. 3D is the same as in Fig. 2J. This panel was included to explicitly illustrate that, in areas A and AM, the separation between History and Association approximately overlaps. We have added the following clarification to the figure legend accordingly.

      Figure 3D: “The percentage of history neurons and the association index (as defined in Fig. 2J) were overlaid for comparison.”

      (5) When computing the Pseudo R2 for regressor contribution, how was the null model computed? From shuffling all regressors in the model? I think this is fine but it's not fully clear what the intended effect of this procedure is. For the description of Figure 4C it would be good to add a sentence explaining how to interpret the pseudo R^2.

      The null model predicts a fixed value that is independent of the explanatory variables, i.e., it predicts only the intercept. This provides a useful correction term when performing cross-validation, particularly in cases where baseline values differ across folds. In Figure 4C, the analysis shows the contribution of adding body part positions and pupil diameter to the model for predicting neural activity. We have added the following text to the Methods section.

      Line 881: “To estimate the contribution of parameters for the left forelimb, the right forelimb, the tail, and the pupil, we repeated the same analysis with a reduced model where each set of predictors was eliminated from the full model (Figure 4B). Then, the pseudo-R<sup>2</sup> was obtained for each set of predictors by (MSE<sub>reduced</sub>MSE<sub>full</sub>) /MSE<sub>null</sub>, where MSE is the mean squared error, MSE<sub>reduced</sub> is MSE for the reduced model, MSE<sub>full</sub> is the MSE of the full model, and MSE<sub>null</sub> is the null model. The null model predicts a fixed value that is independent of the explanatory variables; specifically, it simply outputs the mean of the training data. For example, we constructed a regression model without the parameters regarding the left forelimb (green shade of Figure 4B), obtained MSE<sub>reduced</sub> for the left forelimb, and the pseudo-R<sup>2</sup> was calculated as above by comparing the MSE of the full model and the null model. This value reflects the extent to which the position of the left forelimb contributes to the prediction of neuronal activity.”

      (6) It seems surprising that the pupil-size-related neurons were mapped around visual areas although the pupil should carry clear luminance information. Is this because the luminancerelated information in the pupil can also be explained by the stimulus variable in the model?

      Pupil size changed markedly before and after visual stimulus presentation (Figure S5C), dilating during the black stimulus and constricting during the video stimulus. This likely reflects changes relative to the luminance of the gray screen presented in the absence of visual stimuli. In our encoding model, visual stimuli are included as independent regressors for each corresponding time window. Therefore, pupil fluctuations that are temporally locked to visual stimulation are explained by these visual regressors. Neuronal activity that is better explained by pupil size changes not accounted for by the visual regressors is classified as pupil-related. At least three mechanisms may underlie the influence of pupil size on neuronal activity. First, fluctuations in pupil diameter have been linked to behavioral state or noradrenergic level [REF], which can act as variables independent of visual stimulation. Second, pupil fluctuations may be amplified in a stimulus-dependent manner, reflecting nonlinear interactions between visual input and brain state. Third, changes in pupil diameter alter the amount of light reaching the retina, which can modulate activity in visual cortical areas. The latter two mechanisms are therefore expected to predominantly affect visual areas and may explain why pupil-related neurons are more frequently observed there. The first mechanism is likely related to global brain state, and its association with behavior may account for the presence of pupil-related neurons in S1. However, these interpretations require confirmation through more refined causal manipulations. Accordingly, we limited the addition to the manuscript to the following statement.

      Line 292: “We found that the neurons related to the tail and forepaws were similarly distributed around the parietal cortex including S1 and A, while the pupil-size related neurons were mapped around visual areas (Figure 4C). Changes in pupil diameter may influence neuronal activity through multiple mechanisms, including behavioral state or noradrenergic level [REF], nonlinear interactions with visual stimulation, and changes in the amount of light reaching the retina.”

      (7) What is meant by 'external control parameters such as a video frame' when explaining the encoding model?

      Thank you for the comment. We added the following explanation.

      Line 151: “In the encoding model, the activity of each neuron was fitted by a weighted sum of external control parameters, such as video frames, and behavioral parameters, such as choice and reward direction. Because the visual stimulus changes continuously over time, sliding time windows were placed during the visual stimulus period.”

      (8) What does the trace in Figure 2G show? Is this a single-cell example? What are the axes here?

      We added an explanation to the figure legend.

      Figure 2G: “Schematic of our encoding model. The bottom right panel shows an example of single-neuron activity with an overlay of the fitting obtained by the encoding model.”

      (9) There seems to be a word missing in the sentence that describes the results for Figure 3O in the main text.

      Thank you for the comment. We added the following description related to Fig. 3O.

      Line 247: “resulting in the decoding accuracy of time after a specific choice being lower than in A (Figure 3O).”

      (10) The abbreviation RP is used when describing Figure S5A. It should be mentioned that this refers to the response period.

      Thank you for the comment. We added the following description related to Figure S5A.

      Line 283: “We found that the angle of the tail was significantly different from the baseline values several seconds after the response period (RP) (Figure S5A)”

      (11) I can't see the color difference between the traces in Figure 2E. There are probably red and green but this is hard to see for readers with red-green color blindness. Does the black indicate the time of visual stimulation? Is the line in Figure 2F the time when the spouts move in?

      Thank you for the comment. In Fig. 2E, we improved visibility by changing the line opacity. In addition, the vertical line in Fig. 2E indicates the onset of the visual stimulus, and the vertical line in Fig. 2F indicates the onset of the response period. We have added the following explanations to the figure legend.

      Figure 2: E. “Representative vision neurons (ROI 1-4 in I). The red bars indicate sampling periods during video presentation, and the brown bars indicate sampling periods without video stimulation. Vertical black lines mark the onset of the sampling period. F. Representative choice neuron (ROI 5-8 in I) and a non-selective neuron (ROI 9). Light blue lines indicate the response periods in trials with left choices, and purple lines indicate the response periods in trials with right choices. Vertical black lines mark the onset of the response period.”

      (12) It might be useful to provide a short explanation in the results or methods of why the harmonic mean was used for the computation of the association index. I think it makes sense but since it is not commonly used this could be helpful for the reader to understand the approach.

      Thank you for the comment. We added the following explanation to the main text.

      Line 869: “The association index was determined by the harmonic mean of the rates of vision neurons and choice neurons. The harmonic mean approaches the arithmetic mean when the two values are similar, but becomes closer to the smaller value when the two values differ substantially. Therefore, the association index takes a large value when both vision neurons and choice neurons are abundant.”

      (13) I don't fully understand how coupling diversity is computed. If there are six preference vectors, what is meant by taking the average of angles between all pairs of the two vectors?

      Which two are meant here?

      Thank you for the comment. We revised the explanation as follows.

      Line 950: “To quantify the diversity of coupling patterns across clusters, we computed the angle between every pair of preference vectors. We then averaged these pairwise angles and defined this quantity as the “coupling diversity.”

      (14) The results text states that the high correlation between r_anatomy and r_neuropil (Figure 6I) is evidence for the functional correlations being driven by cortico-cortical connectivity. However, Figure 6J shows that correlations for either cortico-cortical or thalamo-cortical connectivity are below 0.94 and generally higher for thalamo-cortical connectivity. This doesn't negate the general point of the authors but it would be good to clarify this section so it is easier to understand if r_anatomy includes both cortico-cortical and thalamo-cortical data and how the results in Figure I and J go together with the description in the results section.

      You are correct. We have revised the text to clarify that the analysis reflects the combined effects of both cortico-cortical and thalamo-cortical inputs.

      Line 436: “This correspondence suggests that the mesoscale interarea correlation is determined by the cortico-cortical and thalamo-cortical common input at mesoscale. Figure S8: A. Using Allen connectivity atlas, the axonal density of cortico-cortical and thalamo-cortical projection was analyzed.”

      (15) I'm not very familiar with canonical correlation analysis and found this part hard to follow. Some additional explainer sentences would be helpful here. For example, what does it mean to take the average of the top 10 canonical correlations as rt_population? What exactly are the canonical correlation vectors? It was also not clear to me what exactly the results in Figure 5J signify.

      Thank you for the comment. We have clarified the description in the main text related to CCA and the associated analyses as follows.

      Line 374: “Next, to investigate r<sub>t</sub> of the population activity (r<sub>t_population</sub>), we first reduced the dimension of population activity in each area into 10 by using PCA (principal component analysis) (Figure S6B,C). Then, “fluctuation activity” was recalculated for each dimension and trial type, analogous to the single-neuron analysis described above, but here representing noise in population-level activation patterns. We applied CCA (canonical correlation analysis) to each pair of areas and obtained an average of 10 canonical correlations (CC<sub>t</sub>) as r<sub>t_population</sub>. CCA identifies pairs of linear combinations of population activity from two areas that maximize their correlation across trials, thereby capturing shared population-level fluctuations. The CC<sub>t</sub> structure between areas was similar across task types (Figure 5H) indicating that this structure reflects the underlying functional connectivity independent of the task. The CC<sub>t</sub> between A and S1t was the largest among all the pairs (Figure 5H), whereas when the CC<sub>t</sub> was averaged across all connections for each area, A and AM had the largest and second largest CC<sub>t</sub>, respectively (Figure 5I). The dominance in CC<sub>t</sub> in A and AM disappeared when the neurons with r<sub>t,single</sub> >0.3 were removed. Notably, the CC<sub>t</sub> of AM and the other areas was uniform regardless of the paired areas across all 10 canonical components (Figure 5J). Thus, area AM is an integration hub of interareal communication, whereas A simply coupled with S1t, and such a correlation structure at the population level critically depends on this subset of neurons.”

    1. eLife Assessment

      This valuable study proposes a novel rapid-entry mechanism for S. aureus, involving the rapid release of calcium from lysosomes. The paper's strength lies in its very interesting hypothesis. The methods used are solid and adequately support the conclusions.

    2. Reviewer #2 (Public review):

      In the manuscript Ruhling et al propose a rapid uptake pathway that is dependent on lysosomal exocytosis, lysosomal Ca2+ and acid sphingomyelinase, and further suggest that the intracellular trafficking and fate of the pathogen is dictated by the mode of entry. Overall, this is manuscript argues for an important mechanism of a 'rapid' cellular entry pathway of S.aureus that is dependent on lysosomal exocytosis and acid sphingomyelinase and links the intracellular fate of bacterium including phagosomal dynamics, cytosolic replication and host cell death to different modes of uptake.

      Key strength is the nature of the idea proposed, while continued reliance on inhibitor treatment combined with lack of phenotype / conditional phenotype for genetic knock out is a major weakness.

      In the revised version, the authors perform experiments with ASM KO cells to provide genetic evidence of the role for ASM in S. aureus entry through lysosomal modulation. The key additional experiment is the phenotype of reduced bacterial uptake in low serum, but not in high serum conditions. The authors suggest this could be due to the SM from serum itself affecting the entry. While this explanation is plausible, prolonged exposure of cells to low serum is well documented to alter several cellular functions, particularly in the context of this manuscript, lysosomal positioning, exocytosis and Ca2+ signaling. A better control here could be WT cells grown in low serum. If SM in serum can interfere, why do they see such pronounced phenotype on bacterial entry in WT cells upon chemical inhibition?

      While the authors argue a role for undetectable nano-scale Cer platforms on the cell surface caused by ASM activity, results do not rule out a SM independent role in the cellular uptake phenotype of ASM inhibitors.

      The authors have attempted to address many of the points raised in the previous revision. While the new data presented provide partial evidence, the reliance on chemical inhibitors and lack of clear results directly documenting release of lysosomal Ca2+, or single bacterial tracking, or clear distinction between ASM dependent and independent processes dampen the enthusiasm.

      I acknowledge the author's argument of different ASM inhibitors showing similar phenotypes across different assays as pointing to a role for ASM, but the lack of phenotype in ASM KO cells is concerning. The author's argument that altered lipid composition in ASM KO cells could be overcoming the ASM-mediated infection effects by other ASM-independent mechanisms is speculative, as they acknowledge, and moderates the importance of ASM-dependent pathway. The SM accumulation in ASM KO cells does not distinguish between localized alterations within the cells. If this pathway can be compensated, how central is it likely to be ?

      The authors allude to lower phagosomal escape rate in ASM KO cells compared to inhibitor treatment, which appears to contradict the notion of uptake and intracellular trafficking phenotype being tightly linked. As they point out, these results might be hard to interpret. Could an inducible KD system recapitulate (some of) the phenotype of inhibitor treatment? If S. aureus does not escape phagosome in macrophages, could it provide a system to potentially decouple the uptake and intracellular trafficking effects by ASM (or its inhibitor treatment) ?

      The role of ASM on cell surface remains unclear. The hypothesis proposed by the authors that the localized generation of Cer on the surface by released ASM leads to generation of Cer-enriched platforms could be plausible, but is not backed by data, technical challenges to visualize these platforms notwithstanding. These results do not rule out possible SM independent effects of ASM on the cell surface, if indeed the role of ASM is confirmed by controlled genetic depletion studies.

      The reviewer acknowledges technical challenges in directly visualizing lysosomal Ca2+ using the methods outlined. Genetically encoded lysosomal Ca2+ sensor such as Gcamp3-ML1 might provide better ways to directly visualize this during inhibitor treatment, or S. aureus infection.

    3. Author response:

      The following is the authors’ response to the previous reviews

      Public Reviews:

      Reviewer #2 (Public review):

      In the manuscript, Ruhling et al propose a rapid uptake pathway that is dependent on lysosomal exocytosis, lysosomal Ca2+ and acid sphingomyelinase, and further suggest that the intracellular trafficking and fate of the pathogen is dictated by the mode of entry. Overall, this is manuscript argues for an important mechanism of a 'rapid' cellular entry pathway of S.aureus that is dependent on lysosomal exocytosis and acid sphingomyelinase and links the intracellular fate of bacterium including phagosomal dynamics, cytosolic replication and host cell death to different modes of uptake.

      Key strength is the nature of the idea proposed, while continued reliance on inhibitor treatment combined with lack of phenotype for genetic knock out is a major weakness.

      We agree with the reviewer that a S. aureus invasion phenotype in ASM K.O. cells would unequivocally demonstrate the importance of ASM for the process. In the revised manuscript, we report an invasion phenotype in ASM K.O. cells. The absence of an invasion phenotype in ASM K.O. cells in our original experiments was likely caused by SM accumulation in ASM-depleted cells originating from FBS (see Figure 2I, in the revised manuscript).

      We thus cultured cells for up to three days in 2% FBS and then reduced the concentration to 1% FBS one day prior to experimentation. Under these conditions reduced S. aureus invasion in ASM K.O.s was observed when compared to wildtype cells.

      This was not detected when we cultured the cells in medium containing the common concentration of 10% FBS. Our new data supports the results we acquired with three different ASM inhibitors.

      The invasion defect in ASM K.O.s cultured in low FBS was more pronounced at 10 min p.i. when compared to the 30 minute time point (Figure 2K), further corroborating that the ASM-dependent invasion pathway is relevant early in infection. This is consistent with the invasion dynamics we observed upon interference with lysosomal Ca<sup>2+</sup> signaling [TPC1 K.O. (Figure 1C), BAPTA-AM (Figure 3D)], lysosomal exocytosis [Syt7 K.O. (Figure 2F), Ionomycin (Figure 3D)] and ASM activity by inhibitor treatment (Figure 3D).

      Originally, we had hypothesized that changes in the sphingolipidome induced by absence of ASM may have caused the lack of an S. aureus invasion phenotype. We thus compared the sphingolipidome of ASM K.O.s cultured in 1% and 10% FBS. Indeed, SM accumulation was less severe when we cultured the cells in 1% FBS (Figure 2M and Supp. Figure 3). Hence, we think that strong SM accumulations in ASM K.O. cells cultured in 10% FBS may facilitate ASM-independent invasion mechanisms and thus, the absence of ASM-dependent invasion could not be detected by analyzing the number of invaded bacteria. This is supported by experiments, where we treated ASM K.O.s with the ASM inhibitor ARC39, which only slightly affected S. aureus invasion, whereas we detected a strong reduction of internalized bacteria by ARC39 treatment of WT cells (Figure 2 J). We think that this experiment and the reduced invasion in ASM K.O.s rule out an ASM/SM-independent effect of the inhibitors.

      - While the authors argue a role for undetectable nano-scale Cer platforms on the cell surface caused by ASM activity, results do not rule out a SM independent role in the cellular uptake phenotype of ASM inhibitors.

      We agree with reviewer that we do not show formation of ceramide-enriched platforms, and we thus changed the manuscript accordingly (see below).

      - The authors have attempted to address many of the points raised in the previous revision. While the new data presented provide partial evidence, the reliance on chemical inhibitors and lack of clear results directly documenting release of lysosomal Ca2+, or single bacterial tracking, or clear distinction between ASM dependent and independent processes dampen the enthusiasm.

      We shared the reviewer’s desire to discriminate between ASM-dependent and ASM-independent processes, but we are limited by cell biology and the simultaneous occurrence of processes - here the uptake of bacteria by multiple pathways.

      However, we were able to address ASM-dependency of our rapid uptake mechanism by observing a genetic phenotype in SMPD1 knockout-cells.

      We here do not make any assumptions on the centrality of the pathway and its importance in vivo. As scientists we were interested in the fact that such an ASM dependent pathway existed. In different as of yet still unidentified cell lines such a pathway may pose the main entry point for bacteria. Or maybe it represent an ASM-dependent mode of receptor uptake which we have identified with the bacteria piggy-backing into the cells.

      - I acknowledge the author's argument of different ASM inhibitors showing similar phenotypes across different assays as pointing to a role for ASM, but the lack of phenotype in ASM KO cells is concerning. The author's argument that altered lipid composition in ASM KO cells could be overcoming the ASM-mediated infection effects by other ASM-independent mechanisms is speculative, as they acknowledge, and moderates the importance of ASM-dependent pathway. The SM accumulation in ASM KO cells does not distinguish between localized alterations within the cells. If this pathway can be compensated, how central is it likely to be?

      We are convinced that our new genetic evidence of an S. aureus invasion phenotype in ASM K.O.s will eliminate the reviewer’s concerns about the role of ASM during the bacterial invasion.

      The new lipidomics data of ASM K.O.s cultured in 1% and 10% FBS (Figure 2, M, Supp. Figure 3) and inhibitor-treated WT cells (Figure 2L, Supp. Figure 3) show a correlation between SM accumulation and the invasion phenotype.

      We agree with the reviewer, however, that the reason why changes in sphingolipidome increase ASM-independent S. aureus internalization by host cells remains elusive. One possible explanation is a dysfunction of the lipid raft-associated protein caveolin-1 upon strong SM accumulation, which was previously shown to appear in ASM-deficient cells (1, 2). A lack of caveolin-1 results in strongly increased host cell entry of S. aureus (3, 4). Characterization of the mechanism behind these observations requires further experimentation and is beyond the scope of the current manuscript.

      Host cells possess mechanisms to prevent infections, while pathogens developed strategies to circumvent these defense processes. In the present scenario, a physiological membrane composition of the host cell represents such a pathogen defense mechanism (as shown e.g. for caveolin-1 that restricts invasion of S. aureus in healthy cells). If a defense mechanism is disabled (as we speculate it is the case upon strong SM accumulation in ASM K.O.s cultured in 10%FBS), infection is facilitated. In healthy WT cells, these mechanisms (e.g. caveolin-1) are functional and, hence, we would not expect a “compensation” of ASM-dependent invasion. We here analyze invasion events that cannot be prevented by host defense mechanisms as they occur in untreated WT cells and are absent upon interfering with the ASM-dependent invasion pathway (by inhibitors and genetic K.O.). Thus, we think the ASM-dependent pathway, which mediates 50-70% of bacteria internalized by healthy WT cells 10 min p.i., is central for the infection.

      - The authors allude to lower phagosomal escape rate in ASM KO cells compared to inhibitor treatment, which appears to contradict the notion of uptake and intracellular trafficking phenotype being tightly linked. As they point out, these results might be hard to interpret.

      We measured phagosomal escape of S. aureus JE2 in ASM K.O. cells cultured in 1% FBS. Again, we infected cells for 10 or 30 min and determined the escape rates 3h p.i. However, the results are similar to escape rates determined with 10% FBS (Author response image 1).

      Escape rates of S. aureus were significantly decreased in absence of ASM regardless of the FBS concentration in the medium. We therefore think that prolonged absence of ASM has other side effects. For instance, certain endocytic pathways could be up- or down-regulated to adapt for the absence of ASM or could be affected by other changes in the lipidome (that can be minimized but not completely prevented by culturing cells in 1% FBS). This could, for instance, affect maturation of S. aureus-containing phagosomes and hence phagosomal escape.

      Author response image 1.

      As it is unclear how prolonged absence of ASM can affect cellular processes, we think other experiments investigating the role of ASM-dependent invasion for phagosomal escape are more reliable. Most importantly, bacteria that enter host cell early during infection (and thus, predominantly via the “rapid” ASM-dependent pathway) possess lower phagosomal escape rates than bacteria that entered host cells later during infection (Figure 5, D and E). This is confirmed by higher escapes rates upon blocking ASM-dependent invasion with Vacuolin-1 (Figure 4E) and three different ASM inhibitors (Figure 4C and D). We further demonstrate that sphingomyelin on the plasma membrane during invasion influences phagosomal escape, while sphingomyelin levels in the phagosomal membrane did not change phagosomal escape (Figure5 a and b). This is summarized in Figure 5F.

      - Could an inducible KD system recapitulate (some of) the phenotype of inhibitor treatment ? If S. aureus does not escape phagosome in macrophages, could it provide a system to potentially decouple the uptake and intracellular trafficking effects by ASM (or its inhibitor treatment)?

      Inducible knock-downs in our laboratory are based on the vector pLVTHM in cells co-expressing the repressor TetR fused to a KRAB domain. It needs to be stated that for optimal knock-downs the induction has to be performed by doxycycline supplementation in the medium for 7 days thus leading to several days of growth of the cells, which will allow the cells to adapt their lipid metabolism thus reflecting a situation that we encounter for the K.O.s.

      ASM-dependent uptake of S. aureus in macrophages has been demonstrated before (5). However, the course of infection in macrophages differs from non-professional phagocytes (6). E.g. in macrophages, S. aureus replicates within phagosomes, whereas in non-professional phagocytes replicates in the host cytosol. Absence of ASM therefore may influence the intracellular infection of macrophages with S. aureus in a distinct manner.

      - The role of ASM on cell surface remains unclear. The hypothesis proposed by the authors that the localized generation of Cer on the surface by released ASM leads to generation of Cer-enriched platforms could be plausible, but is not backed by data, technical challenges to visualize these platforms notwithstanding. These results do not rule out possible SM independent effects of ASM on the cell surface, if indeed the role of ASM is confirmed by controlled genetic depletion studies.

      We agree with the reviewer that we do not show generation of ceramide-enriched platforms. We thus changed Figure 6F in the revised manuscript to make clear that it remains elusive whether ceramide-enriched platforms are formed. We also added a sentence to the discussion (line 615) to emphasize that the existence of these microdomains is still debated in lipid research.

      We think that the following observations support SM-dependent effects of ASM during S. aureus invasion:

      (i) reduced invasion upon removing SM from the plasma membrane (Figure 2N, Supp. Figure 2M)

      (ii) increased invasion in TPC1 and Syt7 K.O. (Figure 2, P) in presence of exogenously added SMase.

      However, we agree with the reviewer that we do not directly demonstrate ASM-mediated SM cleavage during S. aureus invasion. Hence, we added a sentence to the discussion that mentions a possible SM-independent role of ASM for invasion (line 556) that reads:

      “Since it remains elusive to which extent ASM processes SM on the plasma membrane during S. aureus invasion, one may speculate that ASM could also have functions other than SM metabolization during host cell entry of the pathogen. However, we did not detect a direct interaction between S. aureus and ASM in an S. aureus-host interactome screen (7).”

      - The reviewer acknowledges technical challenges in directly visualizing lysosomal Ca2+ using the methods outlined. Genetically encoded lysosomal Ca2+ sensor such as Gcamp3-ML1 might provide better ways to directly visualize this during inhibitor treatment, or S. aureus infection.

      We thank the reviewer for this suggestion. We included the following section in our discussion (line 593):

      “Since fluorescent calcium reporters allow to monitor this process microscopically (8, 9) ,future experiments may visualize this process in more detail and contribute to our understanding of the underlying signaling. mechanisms.”

      References

      (1) J. Rappaport, C. Garnacho, S. Muro, Clathrin-mediated endocytosis is impaired in type A-B Niemann-Pick disease model cells and can be restored by ICAM-1-mediated enzyme replacement. Mol Pharm 11, 2887-2895 (2014).

      (2) J. Rappaport, R. L. Manthe, C. Garnacho, S. Muro, Altered Clathrin-Independent Endocytosis in Type A Niemann-Pick Disease Cells and Rescue by ICAM-1-Targeted Enzyme Delivery. Mol Pharm 12, 1366-1376 (2015).

      (3) C. Hoffmann et al., Caveolin limits membrane microdomain mobility and integrin-mediated uptake of fibronectin-binding pathogens. J Cell Sci 123, 4280-4291 (2010).

      (4) L.-P. Tricou et al., Staphylococcus aureus can use an alternative pathway to be internalized by osteoblasts in absence of β1 integrins. Scientific Reports 14, 28643 (2024).

      (5) C. Li et al., Regulation of Staphylococcus aureus Infection of Macrophages by CD44, Reactive Oxygen Species, and Acid Sphingomyelinase. Antioxid Redox Signal 28, 916-934 (2018).

      (6) A. Moldovan, M. J. Fraunholz, In or out: Phagosomal escape of Staphylococcus aureus. Cell Microbiol 21, e12997 (2019).

      (7) M. Rühling, F. Schmelz, A. Kempf, K. Paprotka, J. Fraunholz Martin, Identification of the Staphylococcus aureus endothelial cell surface interactome by proximity labeling. mBio 0, e03654-03624 (2025).

      (8) D. Shen et al., Lipid storage disorders block lysosomal trafficking by inhibiting a TRP channel and lysosomal calcium release. Nat Commun 3, 731 (2012).

      (9) L. C. Davis, A. J. Morgan, A. Galione, NAADP-regulated two-pore channels drive phagocytosis through endo-lysosomal Ca(2+) nanodomains, calcineurin and dynamin. EMBO J 39, e104058 (2020).

    1. eLife Assessment

      This paper reports new data on the structure of the human CTF18-RFC clamp loader complex bound to the PCNA clamp. The new and convincing data complement previous reports of CTF-RFC-PCNA structures and as such, represents an important contribution.

    2. Reviewer #1 (Public review):

      Summary:

      The authors report the structure of the human CTF18-RFC complex bound to PCNA. Similar structures (and more) have been reported by the O'Donnell and Li labs. This study should add to our understanding of CTF18-RFC in DNA replication and clamp loaders in general. However, there are numerous major issues that I recommend the authors fix.

      Strengths:

      The structures reported are strong and useful for comparison with other clamp loader structures that have been reported lately.

    3. Reviewer #2 (Public review):

      Summary

      Briola and co-authors have performed a structural analysis of the human CTF18 clamp loader bound to PCNA. The authors purified the complexes and formed a complex in solution. They used cryo-EM to determine the structure to high resolution. The complex assumed an auto-inhibited conformation, where DNA binding is blocked, which is of regulatory importance and suggests that additional factors could be required to support PCNA loading on DNA. The authors carefully analysed the structure and compared it to RFC and related structures.

      Strength & Weakness

      Their overall analysis is of high quality, and they identified, among other things, a human-specific beta-hairpin in Ctf18 that flexible tethers Ctf18 to Rfc2-5. Indeed, deletion of the beta-hairpin resulted in reduced complex stability and a reduction in the rate of primer extension assay with Pol ε. Moreover, the authors identify that the Ctf18 ATP-binding domain assumes a more flexible organisation.

      The data are discussed accurately and relevantly, which provides an important framework for rationalising the results.

      All in all, this is a high-quality manuscript that identifies a key intermediate in CTF18-dependent clamp loading.

    4. Reviewer #3 (Public review):

      Summary:

      CTF18-RFC is an alternative eukaryotic PCNA sliding clamp loader which is thought to specialize in loading PCNA on the leading strand. Eukaryotic clamp loaders (RFC complexes) have an interchangeable large subunit which is responsible for their specialized functions. The authors show that the CTF18 large subunit has several features responsible for its weaker PCNA loading activity, and that the resulting weakened stability of the complex is compensated by a novel beta hairpin backside hook. The authors show this hook is required for the optimal stability and activity of the complex.

      Relevance:

      The structural findings are important for understanding RFC enzymology and novel ways that the widespread class of AAA ATPases can be adapted to specialized functions. A better understanding of CTF18-RFC function will also provide clarity into aspects of DNA replication, cohesion establishment and the DNA damage response.

      Strengths:

      The cryo-EM structures are of high quality enabling accurate modelling of the complex and providing a strong basis for analyzing differences and similarities with other RFC complexes. They use complementary pre-steady state FRET and polymerase primer extension assays to investigate the role of a unique structural element in CTF18.

      Weaknesses:

      The manuscript would have benefited from a more detailed biochemical analysis using mutagenesis and assays to tease apart the functional relevance of the many differences with the canonical RFC complex.

      Overall appraisal:

      Overall, the work presented here is solid and important. The data is sufficient to support the stated conclusions.

    5. Author response:

      The following is the authors’ response to the previous reviews.

      Public Reviews: 

      Reviewer #1 (Public review): 

      Summary: 

      The authors report the structure of the human CTF18-RFC complex bound to PCNA. Similar structures (and more) have been reported by the O'Donnell and Li labs. This study should add to our understanding of CTF18-RFC in DNA replication and clamp loaders in general. However, there are numerous major issues that I recommend the authors fix. 

      Strengths: 

      The structures reported are strong and useful for comparison with other clamp loader structures that have been reported lately. 

      Comments on revisions: 

      The revised manuscript is greatly improved. The comparison with hRFC and the addition of direct PCNA loading data from the Hedglin group are particular highlights. I think this is a strong addition to the literature.

      We thank the reviewer for their positive comments.  

      I only have minor comments on the revised manuscript. 

      (1) The clamp loading kinetic data in Figure 6 would be more easily interpreted if the three graphs all had the same x axes, and if addition of RFC was t=0 rather than t=60 sec.

      We now analyze and plot EFRET as a function of time after complex addition, effectively setting the loader addition to t = 0 for each trace (Figure 6 and Figs S10-14 in the new manuscript). Baseline (Ymin) and plateau (Ymax) EFRET values were obtained by averaging the stable signal regions immediately before and after clamp-loader addition, respectively. Traces are normalized to their own dynamic range before fitting.

      (2) The author's statement that "CTF18-RFC displayed a slightly faster rate than RFC" seems to me a bit misleading, even though this is technically correct. The two loaders have indistinguishable rate constants for the fast phase, and RFC is a bit slower than CTF18-RFC in the slow phase. However, the data also show that RFC is overall more efficient than CTF18-RFC at loading PCNA because much more flux through the fast phase (rel amplitudes 0.73 vs 0.36). Because the slow phase represents such a reduced fraction of loading events, the slight reduction in rate constant for the slow phase doesn't impact RFC's overall loading. And because the majority of loading events are in the fast phase, RFC has a faster halftime than CTF18-RFC. (Is it known what the different phases correspond to? If it is known, it might be interesting to discuss.)

      We removed the quoted statement. We avoid comparing amplitude partitions (A₁/A_T) for CTF18-RFC because (i) a substantial fraction of the reaction occurs within the <7 s dead time, and (ii) single- vs double-exponential identifiability differs across complexes. Instead, we report model-minimal progress times: RFC t<sub>0.5</sub> ≤ 7 s (faster onset), CTF18-RFC ~ 8 s, CTF18<sup>Δ165–194</sup>-RFC ~ 12 s; completion (t<sub>0.95</sub>): RFC ≈ 77 s, CTF18-RFC ≈ 77 s, mutant ≈ 145 s. This shows RFC has the steeper onset, while CTF18-RFC catches up in completion, and the mutant is slower overall. We briefly note that RFC’s phases have been assigned in prior stopped-flow work and are consistent with a rapid entry step and a slower repositioning/complex release phase; we do not assign phases for CTF18-RFC here and instead rely on model-minimal timing comparisons to avoid over-interpretation. 

      (3) AAA+ is an acronym for "ATPases Associated with diverse cellular Activities" rather than "Adenosine Triphosphatase Associated". 

      Corrected to ATPases Associated with diverse cellular Activities (AAA+).

      Reviewer #2 (Public review): 

      Summary 

      Briola and co-authors have performed a structural analysis of the human CTF18 clamp loader bound to PCNA. The authors purified the complexes and formed a complex in solution. They used cryo-EM to determine the structure to high resolution. The complex assumed an auto-inhibited conformation, where DNA binding is blocked, which is of regulatory importance and suggests that additional factors could be required to support PCNA loading on DNA. The authors carefully analysed the structure and compared it to RFC and related structures. 

      Strength & Weakness 

      Their overall analysis is of high quality, and they identified, among other things, a humanspecific beta-hairpin in Ctf18 that flexible tethers Ctf18 to Rfc2-5. Indeed, deletion of the beta-hairpin resulted in reduced complex stability and a reduction in a primer extension assay with Pol ε. Moreover, the authors identify that the Ctf18 ATP-binding domain assumes a more flexible organisation. 

      The data are discussed accurately and relevantly, which provides an important framework for rationalising the results. 

      All in all, this is a high-quality manuscript that identifies a key intermediate in CTF18-dependent clamp loading. 

      Comments on revisions: 

      The authors have done a nice job with the revision. 

      We thank the reviewer for their very positive comments.

      Reviewer #3 (Public review): 

      Summary: 

      CTF18-RFC is an alternative eukaryotic PCNA sliding clamp loader which is thought to specialize in loading PCNA on the leading strand. Eukaryotic clamp loaders (RFC complexes) have an interchangeable large subunit which is responsible for their specialized functions. The authors show that the CTF18 large subunit has several features responsible for its weaker PCNA loading activity, and that the resulting weakened stability of the complex is compensated by a novel beta hairpin backside hook. The authors show this hook is required for the optimal stability and activity of the complex. 

      Relevance: 

      The structural findings are important for understanding RFC enzymology and novel ways that the widespread class of AAA ATPases can be adapted to specialized functions. A better understanding of CTF18-RFC function will also provide clarity into aspects of DNA replication, cohesion establishment and the DNA damage response. 

      Strengths: 

      The cryo-EM structures are of high quality enabling accurate modelling of the complex and providing a strong basis for analyzing differences and similarities with other RFC complexes. 

      Weaknesses: 

      The manuscript would have benefited from a more detailed biochemical analysis using mutagenesis and assays to tease apart the differences with the canonical RFC complex. Analysis of the FRET assay could be improved. 

      Overall appraisal: 

      Overall, the work presented here is solid and important. The data is mostly sufficient to support the stated conclusions.

      We thank the reviewer for their mainly positive assessment. Following this reviewer suggestion, we have re-analysed the FRET assay data and amended the manuscript accordingly.

      Comments on revisions: 

      While the authors addressed my previous specific concerns, they have now added a new experiment which raises new concerns. 

      The FRET clamp loading experiments (Fig. 6) appear to be overfitted so that the fitted values are unlikely to be robust and it is difficult to know what they mean, and this is not explained in this manuscript. Specifically, the contribution of two exponentials is floated in each experiment. By eye, CTF18-RFC looks much slower than RFC1-RFC (as also shown previously in the literature) but the kinetic constants and text suggest it is faster. This is because the contribution of the fast exponential is substantially decreased, and the rate constants then compensate for this. There is a similar change in contribution of the slow and fast rates between WT CTF18 and the variant (where the data curves look the same) and this has been balanced out by a change in the rate constants, which is then interpreted as a defect. I doubt the data are strong enough to confidently fit all these co-dependent parameters, especially for CTF18, where a fast initial phase is not visible. I would recommend either removing this figure or doing a more careful and thorough analysis. 

      We appreciate the reviewer’s concern regarding potential overfitting of the kinetic data in Figure 6. To address this, we performed a model-minimal re-analysis designed specifically to avoid parameter covariance and over-interpretation (Figure 6 and Figs S11-14 in the new manuscript). Only data recorded after the instrument’s <7 s dead time were included in the fits, thereby excluding the partially obscured early region of the reaction. For each clamp loader complex, we selected the minimal kinetic model that produced residuals randomly distributed about zero. This approach yielded a single-exponential fit for CTF18-RFC, whereas RFC and CTF18<sup>Δ165–194</sup>-RFC required double-exponential fits; single-exponential models for the latter two complexes left structured residuals, clearly indicating the presence of an additional kinetic phase.

      Rather than relying on co-dependent amplitude and rate parameters, we quantified the reactions by reporting progress times (t<sub>0.5</sub>, t<sub>0.90</sub>, t<sub>0.95</sub>), which provide a model-independent measure of reaction speed. This directly addresses the reviewer’s concern and allows a fair comparison of the relative kinetics among the complexes.

      From this analysis, RFC exhibited the fastest onset (t<sub>0.5</sub> ≤ 7 s; lower bound), while CTF18RFC and CTF18<sup>Δ165–194</sup>-RFC showed progressively slower half-times of approximately 8 s and 12 s, respectively. Completion times further emphasized these differences: both RFC and CTF18-RFC reached 95 % completion at ~77 s, whereas the mutant required ~145 s. Despite these kinetic distinctions, CTF18-RFC and its β-hairpin deletion mutant achieved similar EFRET plateaus, indicating that the mutation slows reaction progression but does not reduce the overall extent of PCNA loading.

      Finally, we emphasize that our interpretation is deliberately conservative. We do not assign distinct kinetic phases to CTF18-RFC, as their molecular basis remains unresolved. RFC’s phases have been characterized in prior stopped-flow studies, but CTF18-RFC likely follows a distinct or simplified pathway. Our conclusions are thus limited to what the data unambiguously support: deletion of the Ctf18 β-hairpin decreases the rate—but not the extent—of PCNA loading, consistent with the reduced stimulation of Pol ε primer extension observed under single-turnover conditions.

    1. eLife Assessment

      This important study reports that EEG recordings of the earliest stage of information processing in human visual cortex can be used to predict subsequent choice responses. The findings provide novel, convincing evidence for integrative processing in low-level sensory cortices at the level of scalp-recorded potentials, with the exact nature of the neural signals at the single cell level to be determined. The paper is likely to be of interest to neuroscientists interested in the contribution of early sensory signals to decision making.

    2. Reviewer #1 (Public review):

      General assessment of the work

      In this manuscript, Mohr and Kelly show that the C1 component of the human VEP is correlated with binary choices in a contrast discrimination task, even when the stimulus is kept constant and confounding variables are considered in the analysis. They interpret this as evidence for the role V1 plays during perceptual decision formation. Choice-related signals in single sensory cells are enlightening because they speak to the spatial (and temporal) scale of the brain computations underlying perceptual decision making. However, similar signals in aggregate measures of neural activity offer a less direct window and thus less insight into these computations. The authors do a good job justifying their focus on the C1 component and illustrating how it may behave under different simulated scenarios. The results are interesting, although it is difficult to specify which reasonable hypothesis is exactly ruled out by these results. One interpretation is that V1 activity directly guides perceptual decisions in this task. Alternatively, higher-level areas may do this, provided that their activity largely reflects their V1-inputs. This certainly seems possible in a simple task like this.

      Summary of substantive concerns

      I have no substantive concerns about the revised version of the paper.

    3. Reviewer #2 (Public review):

      Summary:

      Mohr and Kelly report a high-density EEG study in healthy human volunteers in which they test whether correlations between neural activity in primary visual cortex and choice behavior can be measured non-invasively. Participants performed a contrast discrimination task on large arrays of Gabor gratings presented in the upper left and lower right quadrants of the visual field. The results indicate that single-trial amplitudes of C1, the earliest cortical component of the visual evoked potential in humans, predict forced-choice behavior over and beyond other behavioral and electrophysiological choice-related signals. These results constitute an important advance for our understanding of the nature and flexibility of early visual processing.

      Strengths:

      The findings suggest a previously unsuspected role for aggregate early visual cortex activity in shaping behavioral choices.

      The authors extend well-established methods for assessing covariation between neural signals and behavioral output to non-invasive EEG recordings.

      The effects of initial afferent information in primary visual cortex on choice behavior is carefully assessed by accounting for a wide range of potential behavioral and electrophysiological confounds.

      Caveats and limitations are transparently addressed and discussed.

      Weaknesses:

      Due to the inherent limitations of scalp-recorded visual evoked potentials, the results cannot be directly compared to invasive recordings in animal models.

    4. Author response:

      The following is the authors’ response to the original reviews

      Public Reviews:

      Reviewer #1 (Public Review):

      General assessment of the work:

      In this manuscript, Mohr and Kelly show that the C1 component of the human VEP is correlated with binary choices in a contrast discrimination task, even when the stimulus is kept constant and confounding variables are considered in the analysis. They interpret this as evidence for the role V1 plays during perceptual decision formation. Choice-related signals in single sensory cells are enlightening because they speak to the spatial (and temporal) scale of the brain computations underlying perceptual decision-making. However, similar signals in aggregate measures of neural activity offer a less direct window and thus less insight into these computations. For example, although I am not a VEP specialist, it seems doubtful that the measurements are exclusively picking up (an unbiased selection of) V1 spikes. Moreover, although this is not widely known, there is in fact a long history to this line of work. In 1972, Campbell and Kulikowski ("The Visual Evoked Potential as a function of contrast of a grating pattern" - Journal of Physiology) already showed a similar effect in a contrast detection task (this finding inspired the original Choice Probability analyses in the monkey physiology studies conducted in the early 1990's). Finally, it is not clear to me that there is an interesting alternative hypothesis that is somehow ruled out by these results. Should we really consider that simple visual signals such as spatial contrast are *not* mediated by V1? This seems to fly in the face of well-established anatomy and function of visual circuits. Or should we be open to the idea that VEP measurements are almost completely divorced from task-relevant neural signals? Why would this be an interesting technique then? In sum, while this work reports results in line with several single-cell and VEP studies and perhaps is technically superior in its domain, I find it hard to see how these findings would meaningfully impact our thinking about the neural and computational basis of spatial contrast discrimination.

      We agree that single cell measurements allow for a spatially more detailed analysis, but they are not feasible in humans. Assuming we value insights into the relationship between neural activity and decision making in the human as well as non-human brain, we are restricted to non-invasive measurements such as EEG, which inevitably showcase the neural underpinnings of decision making at a coarser level of analysis. This was the challenge we met with our paradigm design. For example, we chose contrast as the task-relevant stimulus feature in this study because monotonic contrast response functions exist for sensory neurons throughout the visual system, and the aggregated measures that we could attain with EEG would reflect that contrast-sensitivity and hence provide a window onto the encoding of the main decision-relevant quantity. We were specifically interested in initial afferent, contrast-dependent V1 activity reflected in the C1 component (80-90 ms). As we point out in the Introduction, the C1 is unusual among EEG signals in the extent to which it is dominated by a single visual area, V1 (Jeffreys & Axford, 1972; Clark et al., 1994; Di Russo et al., 2002; Ales et al., 2010; Mohr et al., 2024), and even if other downstream areas also make a minor contribution in the C1 time period, it still represents a very low-level sensory response early in the sensory analysis pipeline, appropriate for addressing our primary question of whether such a low-level signal is used in the formation of perceptual decisions. The alternative hypothesis, that early responses are passed over in decision readout, relates to a fundamental debate about whether early sensory responses are separated from cognition. The possibility that late, but not early, representations are correlated with choices does not imply that the later sensory representations are divorced from the earlier ones, only that there is a noise component that is not shared between the two, such as that produced by the ensuing computations that generate the later representations. Instead, a lack of choice probability in early representations would imply that decision readout is selective in where it sources sensory evidence from, with some possible reasons being to maintain high quality standards for sensory evidence or to impose a layer of separation between cognition and sensation.

      As the reviewer points out, the animal literature is highly mixed on the topic of choice probability in V1. Even for orientation discrimination tasks where V1 is ostensibly highly suited given the existence of orientation columns in V1, and even when measurements are taken from V1 neurons with good neurometric performance and/or aggregated across a V1 population (Jasper et al 2019), some studies have reported little to no V1 choice probability. If our alternative hypothesis of no EEG-indexed V1 choice probability flies in the face of well-established anatomy and function of visual circuits, then so also do these empirical findings in the animal neurophysiology literature. 

      Although there are important aspects of choice probability that are accessible in single cell studies but not in EEG (e.g. noise correlations, details of circuit physiology), our EEG measurements tap into the same phenomenon, just at a different level of analysis, i.e. the neural population level. At this level, we have been able to address whether the full body of sensory responses at a particular stage of visual analysis is systematically related to perceptual decision outcomes. Very similar questions are in fact sometimes addressed in the animal neurophysiology literature; for example, Kang and Maunsell (2020) aggregated single-cell choice probability measurements within visual areas to investigate whether choice probability strength at the level of an entire visual area was sensitive to task demands. The global vantage point of EEG comes with the additional benefit of picking up signatures of other potentially mediating processes such as attention and being able to control for them in our analysis. Our human study thus provides a valuable complementary viewpoint alongside animal neurophysiology work in this area.

      Summary of substantive concerns:

      (1) The study of choice probability in V1 cells is more extensive than portrayed in the paper's introduction. In recent years, choice-related activity in V1 has also been studied by Nienborg & Cumming (2014), Goris et al (2017), Jasper et al (2019), Lange et al (2023), and Boundy-Singer et al (2025). These studies paint a complex picture (a mixture of positive, absent, and negative results), but should be mentioned in the paper's introduction.

      We thank the reviewer for highlighting these papers bearing on choice-related activity in V1, only two of which we had cited. The three additional studies do indeed lend further support to our description of the complex picture around V1-CP effects in the literature and we have now included them.

      (2) The very first study to conduct an analysis of stimulus-conditioned neural activity during a perceptual decision-making task was, in fact, a VEP study: Campbell and Kulikowski (1972). This study never gained the fame it perhaps deserves. But it would be appropriate to weave it into the introduction and motivation of this paper.

      We are aware of this paper, and indeed we ourselves have shown steady-state VEP (SSVEP) correlations with timing and selection of decision reports (O'Connell et al 2012; Grogan et al 2023), but SSVEPs do not provide an index of initial afferent V1 activity in the way that the C1 of the transient VEP does. SSVEPs are evoked by a rapid sequence of stimulus onsets, so that activity cannot be attributed to a particular stimulus onset nor its bottom-up latency resolved, and, being a response to an ongoing stimulus, it combines top-down and bottom-up influences from striate and extra striate areas (Di Russo et al 2007). Indeed, in Campbell and Kulikowski (1972) the SSVEP was almost entirely eliminated when the stimulus was undetected. This is in keeping with robust modulations of the SSVEP by spatial attention (Muller and Hillyard 2000). Cognitive influences of this magnitude are never observed in the C1, and in fact are often not observed at all even when later VEP components show robust modulations (Luck et al 2000), which motivated a recent meta-analysis to address the issue (Qin et al 2022). This highlights the important distinction between the earliest transient VEP activity reflecting mainly the initial afferent response in V1, and steady-state sensory activity reflecting a mix of bottom-up and top-down influences across visual cortex. Because of the importance of this distinction, we have added a reference to the above SSVEP papers to the 3rd paragraph of the introduction along with a statement about the distinction.

      (3) What are interesting alternative hypotheses to be considered here? I don't understand the (somewhat implicit) suggestion here that contrast representations late in the system can somehow be divorced from early representations. If they were, they would not be correlated with stimulus contrast.

      This same conundrum applies to single-cell studies of choice probability. Do studies showing choice probability in V4 but not V1 for example demonstrate that V4 is divorced from V1? In such studies, measurements are typically taken from large representative samples of neurons from both areas with good neurometric performance in both cases and the task often (though not always) involves a target stimulus feature that is encoded in V1 such as orientation. Why then should V4 but not V1 show choice probability when we know the vast majority of input to the visual cortex passes through V1? It must be that feature representation and choice formation are different things with one not inferring the other. This is true for an EEG study as much as it is for a single-cell study.

      The alternative hypothesis in our study is that the early sensory responses indexed by the C1 are not directly used in the formation of the perceptual decision at hand. As outlined in our comments above, this does not imply that those early responses are divorced from later responses. Of course, both are correlated with stimulus contrast and so would correlate with each other across changing contrast but this does not necessitate that their noise is correlated when contrast is held constant because new instantiations of noise can be generated by the computations performed at each stage of visual processing. Thus, the interesting alternative hypothesis is that information contained in the sensory representation generated during initial afferent V1 activity is not used directly to form decisions, and instead, decisions are read out from the outputs of computations performed further downstream. Such an outcome, if it had arisen in our data, would have been consistent with a separation between cognition and early visual processing. Instead, our results suggest a certain level of cognitive interfacing at the lowest and earliest cortical levels of visual processing. We have now added text to the Introduction to highlight the distinction between sensory representation and decision readout in order to make the alternative hypothesis clearer.

      (4) I find the arguments about the timing of the VEP signals somewhat complex and not very compelling, to be honest. It might help if you added a simulation of a process model that illustrated the temporal flow of the neural computations involved in the task. When are sensory signals manifested in V1 activity informing the decision-making process, in your view? And how is your measure of neural activity related to this latent variable? Can you show in a simulation that the combination of this process and linking hypothesis gives rise to inverted U-shaped relationships, as is the case for your data?

      We thank the reviewer for this suggestion of a simulation, which we carried out using the Matlab code. We have also included new Figure 1-Figure Supplement 1 in the revised manuscript.

      In our view, sensory signals in V1 are informing the decision-making process in this task from at least as early as the initial afferent response. The main point about C1 latency in relation to the response-time contingency of the choice probability effect is that the more time that elapses without a decision made (and therefore the more additional sensory processing that contributes to the decision), the more diluted is the contribution of the C1 to the decision by contributions from later representations, and thus choice probability reduces. Likewise, when response times are too quick for C1 evidence to contribute, choice probability is also absent, hence the inverted-U-shaped curve. Moreover, if the C1-choice correlation is mediated by a top-down factor such as attention rather than readout, the inverted-U-shaped curve is not expected because in such a case the relative timing of the C1 and choice commitment would not be relevant.

      Reviewer #2 (Public review):

      Summary:

      Mohr and Kelly report a high-density EEG study in healthy human volunteers in which they test whether correlations between neural activity in the primary visual cortex and choice behavior can be measured non-invasively. Participants performed a contrast discrimination task on large arrays of Gabor gratings presented in the upper left and lower right quadrants of the visual field. The results indicate that single-trial amplitudes of C1, the earliest cortical component of the visual evoked potential in humans, predict forced-choice behavior over and beyond other behavioral and electrophysiological choice-related signals. These results constitute an important advance for our understanding of the nature and flexibility of early visual processing.

      Strengths:

      (1) The findings suggest a previously unsuspected role for aggregate early visual cortex activity in shaping behavioral choices.

      (2) The authors extend well-established methods for assessing covariation between neural signals and behavioral output to non-invasive EEG recordings.

      (3) The effects of initial afferent information in the primary visual cortex on choice behavior are carefully assessed by accounting for a wide range of potential behavioral and electrophysiological confounds.

      (4) Caveats and limitations are transparently addressed and discussed.

      We would like to thank the reviewer for these positive remarks.

      Weaknesses:

      (1) It is not clear whether integration of contrast information across relatively large arrays is a good test case for decision-related information in C1. The authors raise this issue in the Discussion, and I agree that it is all the more striking that they do find C1 choice probability. Nevertheless, I think the choice of task and stimuli should be explained in more detail.

      We thank the reviewer for raising this point about the large stimulus arrays. As we said in our Discussion, it would seem that aggregation across a large stimulus region would be better suited to a downstream visual area with larger receptive fields, yet our setting of a strict deadline would put the emphasis back on earlier sensory representations. We now elaborate on this matter in the discussion, to say that although the small receptive fields and short, slow horizontal connections in V1 mean that the aggregation necessary for performing the task is unlikely to happen within V1 during the C1 timeframe, the aggregation would be readily achieved simply by convergence of the outputs of all relevant V1 neurons for a given stimulus array on the same decision process. In this sense, the design of our paradigm was such that the globally-measured C1 component on the scalp reflected the same aggregated evidence input as the summed V1 readout that we suppose would be entering the decision process.  

      We have also added further rationale in the Methods section on the practical benefits of the stimulus design, as the reviewer anticipates in their subsequent point, of yielding robust C1 signals. This concern was paramount in the design of this study because we expected the C1 difference metric that was of interest to be very small. We also needed a robust C1 to be measured in both the upper and lower visual field in as many individuals as possible and, in our experience, this is true less often when using smaller stimuli, even with a pre-mapping procedure.

      It also helped to homogenize C1 topography across individuals and ensure that topographies from the upper and lower visual field had sufficient overlap that there were electrodes with strong loading from both topographies where the C1 difference as a function of which array was brighter would be maximal.

      We have updated the methods section to provide these rationales while we describe the stimulus design.

      (2) In a similar vein, while C1 has canonical topographical properties at the grand-average level, these may differ substantially depending on individual anatomy (which the authors did not assess). This means that task-relevant information will be represented to different degrees in individuals' single-trial data. My guess is that this confound was mitigated precisely by choosing relatively extended stimulus arrays. But given the authors' impressive track record on C1 mapping and modeling, I was surprised that the underlying rationale is only roughly outlined. For example, given the topographies shown and the electrode selection procedure employed, I assume that the differences between upper and lower targets are mainly driven by stimulus arms on the main diagonal. Did the authors run pilot experiments with more restricted stimulus arrays? I do not mean to imply that such additional information needs to be detailed in the main article, but it would be worth mentioning.

      We thank the reviewer for their thoughtful consideration of this issue about individual variability in C1 retinotopy. Indeed, as the reviewer anticipated we expected the large stimulus coverage to mitigate this issue and we think that our response to the point above and the changes we made to the manuscript in response address this point also. Although we did not show this in the manuscript, we did in fact find that C1 topography was much more similar across individuals than it has been in previous C1 experiments we have carried out with smaller stimuli.

      However, we acknowledge the reviewer’s point that the signal measured at a specific electrode likely has a variable loading strength from the various gratings in the stimulus array and that the gratings of maximal loading may indeed vary from subject to subject. Such inter-subject variability cannot confound the choice probability effects because the latter are measured within-subject. Nevertheless, it could be a source of noise. We believe the impact of this is unlikely to be substantial for the following reasons:

      i) We designed the spatial spread of contrasts in such a way as to encourage participants to aggregate across the full array. In essence, to match the property of the C1 as an aggregate measure of V1 activity, we designed a task that involved aggregating across stimulus elements. Therefore, the decision weighting applied to any particular grating should be representative of the weighting applied to all gratings and, as such, the specific gratings that contribute most to the C1 signal for a particular participant should be relatively inconsequential.

      ii) By avoiding the horizontal and vertical meridians we avoided the regions of space where the shifts in C1 topography are largest.

      (3) Also, the stimulus arrangement disregards known differences in conduction velocity between the upper and lower visual fields. While no such differences are evident from the maximal-electrode averages shown in Figure 1B, it is difficult to assess this issue without single-stimulus VEPs and/or a dedicated latency analysis. The authors touch upon this issue when discussing potential pre-C1 signals emanating from the magnocellular pathway.

      Indeed, there are important differences in V1 properties between the upper and lower visual fields, visual acuity being another example in addition to conduction velocity as the reviewer points out. However, these differences appeared to be quite minimal in this case (Figure 1B does in fact include a single-stimulus VEP – the “1-stim” entry in the legend). Perhaps this is also due to the large stimulus array which may include a range of conduction velocities within it and thereby blur overall differences between the upper and lower visual field. The variability of contrast within each array was also quite high (+/-20% from the midpoint), which would have further increased within-array conduction velocity variability and blurred differences between arrays.

      Our staircasing procedure may have also helped in this regard to some extent as it included a bias parameter between the arrays to account for any behavioural response biases. Although the small contrast changes it usually incurred are likely much too small to change conduction velocities, it corrected for any effect on behaviour they may have.

      (4) I suspect that most of these issues are at least partly related to a lack of clarity regarding levels of description: the authors often refer to 'information' contained in C1 or, apparently interchangeably, to 'visual representations' before, during, or following C1. However, if I understand correctly, the signal predicting (or predicted by) behavioral choice is much cruder than what an RSA-primed readership may expect, and also cruder than the other choice-predictive signals entered as control variables: namely, a univariate difference score on single-trial data integrated over a 10 ms window determined on the basis of grand-averaged data. I think it is worth clarifying and emphasizing the nature of this signal as the difference of aggregate contrast responses that *can* only be read out at higher levels of the visual system due to the limited extent of horizontal connectivity in V1. I do not think that this diminishes the importance of the findings - if anything, it makes them more remarkable.

      This is true that a univariate measure may stick out in a field increasingly favouring multivariate analyses with the spread of machine learning, and so we have added a short qualifier in the methods section where we describe the C1 measurement to explicitly state that it is a scalar variable. What we have done in using this univariate measure is leverage the rich prior knowledge about V1 anatomy and neurophysiology, rather than trust in data-driven classifiers; interestingly, we found that such a classifier trained on all electrodes discriminates choices less well than our informed univariate measure during the C1 time-frame. 

      We also thank the reviewer for raising an interesting point about the nature of aggregation and readout in the context of our stimulus. We agree that it is not feasible that V1 activity would be aggregated locally in V1 across such large regions of space prior to being readout within the C1 time period. As we say above, the aggregation may instead be carried out through convergent transmission of the parallel, spatially-local V1 information to the decision process.

      (5) Arguably even more remarkable is the finding that C1 amplitudes themselves appear to be influenced by choice history. The authors address this issue in the Discussion; however, I'm afraid I could not follow their argument regarding preparatory (and differential?) weighting of read-outs across the visual hierarchy. I believe this point is worth developing further, as it bears on the issue of whether C1 modulations are present and ecologically relevant when looking (before and) beyond stimulus-locked averages.

      We thank the reviewer for their positive appraisal of this additional finding, which we also found remarkable. We agree that our description of our interpretation was too brief and lacked clarity. We have reworded it and expressed it in terms of the speed accuracy trade-off, with the new explanation given below. However, it is important to remember that this account is speculative and serves only to explain the response-time contingency of the bias. That the bias was present and constitutes a modulation of the C1 does not rest on this argument:

      […] “to explain the RT contingency for the C1 bias, we speculate that the speed-accuracy trade-off could fluctuate from trial to trial and that the corresponding decision bound fluctuations (Heitz and Schall 2012) could be implemented by pre-determining decision weights across visual areas. For example, to achieve faster decisions, the sensory evidence requirement could be reduced by placing greater emphasis on initial afferent V1 evidence. In such a case, the RT contingency of the above choice history bias could be explained if the C1 bias is exerted in proportion with the planned emphasis of C1 evidence for the upcoming decision.”

      Recommendations to the Authors:

      Reviewer #2 (Recommendations for the authors):

      (1) As someone whose first language is not English, I am somewhat hesitant to bring this up, but I found the use of 'readout' as both noun and verb somewhat confusing. I thought read-out was defined as 'that which is read out'.

      We agree that this dual use of the word readout may cause confusion. To avoid this, we have edited the manuscript to replace verbal forms of the word “readout” with “read out”.

      (2) I found it difficult to follow the reasoning for why intermediate RTs should be the ones most affected by C1-related information. Perhaps this could be described in more detail for the uninitiated reader.

      We appreciate that our reasoning for why intermediate RTs should be the ones most affected by C1-related information was difficult to follow. We have now added a simulation to showcase this rationale more clearly - see response to reviewer 1, and new figure supplement to figure 1. 

      (3) It would be interesting to compare the effect sizes observed here to those seen in single-cell studies and to discuss this comparison with regard to differences in the nature of EEG signals and single-cell firing rates.

      While we agree that such a comparison would be interesting if feasible, it would have to be for the same task settings, which have not been used in a single-cell study, and  the very different nature and extent of noise between the two recording modalities would make such a comparison difficult to interpret, e.g. background noise in EEG from ongoing processes unrelated to the task. 

      (4) Figure 1: It may be worth mentioning in the legend that only parts of the peripheral stimulus grid are shown for better visibility, as the Methods speak of 9 x 9 grids. Also, in panel B, it should be mentioned that waveshapes are calculated using individually selected maximal-difference electrodes.

      We thank the reviewer for spotting these. We have updated the caption for this figure to reflect these two observations.

      (5) Figure 4: The different shades of green may be difficult to distinguish when printed.

      Although this may be true, we chose shades of green that differ in luminance so they should still be distinguishable. Different colours may in fact be less distinguishable if they had the same luminance and the print was black-and-white. We chose different shades of the same colour to reflect the fact that we were plotting the same signals at different difficulty levels. In our opinion, this takes precedence since eLife is an online journal so the majority of readers will likely read it digitally.

      (6) Methods/Task: While the ITI of 780 ms is substantial, I was wondering why the authors decided against jittering this interval? It would be helpful to briefly discuss whether contrast adaptation for slow periodic stimulation may have affected the findings.

      We opted against jittering the ITI to avoid an additional source of inter-trial variability. While this may allow for adaptation effects of this source, this would be approximately constant across trials and therefore less of a concern for our design. We have added text to the methods section to state this rationale.

      (7) Methods/Stimuli: The authors convincingly argue that focusing on single arms of the stimuli is an unlikely strategy, but did they ask for participants' strategies during debriefing?

      We are glad that the reviewer found our argument about whether or not participants may have focused on a single arm of the stimuli convincing. We did not ask participants about their strategies but even with such a debriefing, there would still remain a possibility that a participant may have used that strategy but were unaware that they were doing so. In any case, if participants were doing this it would have dampened the strength of our choice probability result. 

      (8) Methods/Procedure, Difficulty Titration: Why did the authors opt for manually adapting the difficulty level in a separate session rather than constantly and automatically titrating difficulty?

      We did this because calculating choice probability requires a comparison of trials with different choice outcomes but the same stimulus so continuously staircasing difficulty level during the experiment would have created a confound. Although this could have been corrected for in our regression, this would have entailed greater noise that we could avoid by staircasing in advance.

    1. eLife Assessment

      This important study links allelic expression imbalance with replication timing, suggesting a stochastic model for haploinsufficiency in dosage-sensitive disease. The integration of allele-specific RNA-seq and replication timing in clonal systems provides solid evidence for an association between asynchronous replication and allelic imbalance, although the scope and generality of some conclusions require more cautious interpretation. This study will interest epigeneticists and genome regulation researchers studying replication timing and monoallelic expression, as well as developmental biologists and human geneticists concerned with clonal heterogeneity, haploinsufficiency, and variable disease penetrance.

      [Editors' note: this paper was reviewed by Review Commons.]

    2. Reviewer #1 (Public review):

      Summary:

      The existence of VERT regions is well supported, but the number of regions called as ISCs may be inflated by permissive thresholds (e.g., AEI {greater than or equal to} 0.8 or {less than or equal to} 0.2 in a single clone). This risks conflating transient stochastic differences with stable ISCs. Similarly, the claim of cell-type specificity is not convincingly demonstrated given the small sample size (n=4) and strong batch confounding between lymphoblastoid and cartilage progenitors. While syntenic VERT regions across mouse and human are intriguing, they complicate interpretation of strong clustering by cell type. Sampling depth may also have exaggerated allelic imbalance calls.

      The proposed role of ISCs in haploinsufficiency is conceptually interesting but remains speculative; developmental stochasticity and founder population size may play larger roles than replication timing. The claim that autosomal inactivation is mechanistically distinct from XCI, however, is reasonable and supported.

      Some conclusions should be more explicitly qualified as preliminary. Cell-type specificity and mitotic stability both require stronger evidence; the latter is inferred indirectly from clonal expansion rather than shown directly, and orthogonal experiments (e.g., allele-specific ChIP-seq, DNA methylation) would be required. Estimated genomic coverage of ISCs should also be re-evaluated, as single-clone observations may inflate counts.

      Replication is limited. Hierarchical clustering is confounded by batch and based on presence/absence calls that lack quantitative resolution. More robust approaches would include using magnitude of imbalance, annotating VERTs by genomic location, applying stricter thresholds for replication timing, and benchmarking AEI distributions against the X chromosome. These are realistic re-analyses requiring no new data and could be completed in ~1 month.

      Methods are generally well described and reproducible. Figures and text would benefit from improved clarity: axis labels are missing in places (e.g., Fig. 1c, Fig. 2g), legends should explain chromosome arm colors, and cluttered figures such as Fig. 1j could be re-visualized for interpretability. Gene set enrichment analysis should be restricted to avoid inflated significance from overly broad categories. A useful citation for XCI timing (pmid=39420003) could be added to strengthen background.

      Significance:

      Conceptually, this work introduces ISC-like phenomena in human and mouse progenitor lines, coupling allelic expression imbalance with replication timing. Technically, it combines allele-specific RNA-seq with Repli-seq in genotyped, clonal, single-cell-derived lines. Clinically, it suggests an alternative model for haploinsufficiency, relevant to dosage-sensitive diseases where stochastic transcriptional delays could shape penetrance.

      The study builds on prior work in allelic exclusion (e.g., HLA, olfactory receptors) and random monoallelic expression, generalizing these phenomena into ISC/vert frameworks and proposing mitotic stability of allele choice. By extending beyond expression to replication timing, the authors suggest a broader paradigm for epigenetic regulation at autosomal loci.

      The paper will be of interest to epigeneticists studying XCI, allelic exclusion, and monoallelic expression; to developmental biologists examining replication timing and differentiation; and to clinicians concerned with dosage-sensitive and haploinsufficient disorders.

    3. Reviewer #2 (Public review):

      Summary:

      - This is a complicated research topic that touches on a few sub-fields of biology, and thus to make the paper more approachable I would recommend a careful edit of the text for clarity and precision of language.<br /> - Authors point out that this is a decades-old field; it would make sense to use terminology established within the field rather than inventing their own. Allelic imbalance has been referred to as AI, MAE (monoallelic expression), RMAE (random monoallelic expression) etc. The paper whose mouse data the authors make use of uses Asynchronous Stochastic Replication Timing (ASRT) instead of VERT to refer to the same phenomenon. Creating unnecessary jargon makes the paper more difficult to read and adds needless complexity to an already complex field.<br /> - Methods do not provide sufficient detail to fully evaluate or reproduce these experiments.<br /> - It is helpful to show representative loci as the authors do in Fig 1F and G and Fig 2, but these panels are very densely rendered and thus difficult to process visually - even the cartoon version (1D) is thick with overlapping lines. The point that allelic imbalance is enriched in VERTs would be enhanced if the authors could present the allelic ratio for all genes found in all VERTs, demonstrating how replication timing on either chromosome affects the allelic ratio.<br /> - The authors make the important point that VERTs are unlikely to be shared among different cell types and tissues (Fig 1i) but then find an enrichment for neuronal and immune genes in VERT regions identified in ACPs. It follows that these same genes are unlikely to be in such regions in the tissues where they are relevant. Some of the GO terms presented are too broad to suggest any biological significance to the result, even if there is statistical significance (for example, the top term for LCL clones 'Cytoplasm' is associated with 12,000 genes, and the second term for mouse clones 'Membrane' is associated with 10,000). It would be helpful to focus on GO terms lower in the GO hierarchy.<br /> - Figure 3 highlights the association of related gene clusters with VERTs but the VERTs are assigned based on variable replication timing in just 1 or 2 clones. This is an interesting observation, but to make the point that "VERT regions frequently coincide with gene clusters in the human genome" there needs to be a systematic assessment of replication timing at all gene clusters across all clones, and a statistical test for significance.<br /> - It is an interesting hypothesis that VERTs are conserved between species at synentic loci. If such regions are really conserved, one would expect that replication timing at these sites would be consistently asynchronous. However, the data presented shows that in human clones these VERTs can be specific to an individual donor (as in 5A) or an individual clone (as in 5H).<br /> - Again, the finding that VERTs coincide with neurodevelopmental disease genes in immune and cartilage cells is at odds with the previous statements and data about the tissue specificity of VERTs. In order to support the claim that neurodevelopmental disease associated genes reside in asynchronously replicating regions, and are thus more prone to allelic imbalance, the authors would need to demonstrate this phenomenon in neuronal cells.

      Significance:

      The authors pair analysis of replication timing and allele-specific expression in clonal populations of primary human cells. They combine these data with previously published data on clones from transformed human cell lines. They identify a number of genomic regions that display asynchronous replication timing in at least one clone and correlate these regions with allele-specific expression of genes within them. They also observe that several interesting gene sets, including genes that are associated with human diseases, map to asynchronously replicating regions. This is a good experimental approach that builds on already published data demonstrating the connection between allelic imbalance and replication timing. However, the authors consistently lean on thin evidence (i.e. a single clone) within a modestly sized dataset (4 clones from 2 donors each) to propose a new model for haploinsufficiency in human disease. The consistent focus on limited elements in the data and perhaps an overreach in the interpretation makes it difficult to appreciate what is in fact a very good experiment.

    4. Author response:

      General Statements

      We thank the reviewers for their thoughtful and constructive comments, which will substantially improve our manuscript. In response, we will revise the text and figures throughout to address the points raised. Specifically, we will:

      i. Refine our definition of Inactivation/Stability Centers (I/SCs): We will limit this designation to loci where both Allelic Expression Imbalance (AEI) and Variable Epigenetic Replication Timing (VERT) are detected, either in the present study or in previously published work.

      ii. Expand methodological clarity: We will provide detailed descriptions of how VERT regions were identified, annotated, and quantified, including thresholds for allelic imbalance, replication timing variability, and sampling depth. We also justify the ≥80% AEI cutoff, which is based on recent studies showing that modest allelic biases can have biological and clinical significance.

      iii. Enhanced benchmarking and validation: In addition to the analysis of X inactivation in female ACP cells, we will include comparisons between imprinted and non-imprinted regions to benchmark the magnitude of allelic replication timing imbalance, demonstrating that the magnitude of imbalance observed at imprinted loci is comparable to that at the non-imprinted VERT regions.

      iv. Address tissue specificity and sampling limitations: We will discuss the limited number of clones, tissues, and individuals analyzed, emphasizing that while our data identify robust AEI and VERT patterns, additional tissues and individuals will be required to capture the full diversity of I/SC regulation.

      v. Clarify biological relevance: We will expand our discussion to highlight the consistency of AEI findings across cell types, including examples of genes implicated in neurodevelopmental and neurodegenerative disorders, and we will clarify our model of how I/SC regulation may contribute to haploinsufficiency, variable expressivity, and incomplete penetrance in human disease.

      vi. Improved figures and supplemental data: We will update figure legends for clarity, add a new supplementary figure comparing imprinted and non-imprinted regions, and cross-reference all supplemental tables.

      We believe these revisions strengthen the manuscript conceptually and experimentally, and we thank the reviewers and editors for their valuable feedback.

      Description of the planned revisions

      Reviewer #1:

      The existence of VERT regions is well supported, but the number of regions called as ISCs may be inflated by permissive thresholds (e.g., AEI {greater than or equal to} 0.8 or {less than or equal to} 0.2 in a single clone). This risks conflating transient stochastic differences with stable ISCs.

      We selected the >80% (or <20%) allelic imbalance threshold, along with the requirement of at least one biallelic clone, as our criterion for significant AEI. This choice was guided by a recent study demonstrating that allelic imbalance as low as a 65%/35% is enough to effect disease penetrance in humans (Nature 2025; 637:1186–1197). For completeness, results obtained using more stringent thresholds (>90% and >95% imbalance) are presented in Supplementary Table 2.

      Furthermore, it is unlikely that transient stochastic differences in allelic expression, such as those detected by single-cell RNA sequencing assays (Nat. Rev. Genet. 2015; 16:653–664), would be captured by our approach. Each clone in our study was expanded from a single cell to over one million cells before both RNA-seq and Repli-seq analysis, effectively averaging out transient transcriptional and/or replication fluctuations, and thus reflecting stable, mitotically heritable epigenetic states.

      More robust approaches would include using magnitude of imbalance, annotating VERTs by genomic location, applying stricter thresholds for replication timing, and benchmarking AEI distributions against the X chromosome.

      All VERT regions identified in this study were annotated according to both the magnitude of allelic imbalance and their genomic coordinates, using 250 kb windows for the human samples and 50 kb windows for the mouse samples (see Supplementary Tables 1 and 6). Figure 1c directly compares the magnitude of imbalance, defined as outliers in the standard deviation, for both allelic replication timing and allelic expression across autosomal and X-linked loci in female ACP cells.

      In addition, we will benchmark the magnitude of replication timing imbalance using autosomal imprinted regions as a second internal control. We detected allelic replication imbalance at 13 known imprinted loci, and the standard deviation of replication timing at these loci, measured in 250 kb windows, is comparable to that observed across the >350 VERT regions detected at non-imprinted sites. To illustrate this comparison, we will include a supplementary figure directly comparing imprinted and non-imprinted regions.

      Figures and text would benefit from improved clarity: axis labels are missing in places (e.g., Fig. 1c, Fig. 2g), legends should explain chromosome arm colors, and cluttered figures such as Fig. 1j could be re-visualized for interpretability.

      Figure labels will be added to Figs. 1c and 2g, and legends will be modified for clarity.

      “the claim of cell-type specificity is not convincingly demonstrated given the small sample size (n=4) and strong batch confounding between lymphoblastoid and cartilage progenitors.” And “Hierarchical clustering is confounded by batch and based on presence/absence calls that lack quantitative resolution.”

      We agree that the limited number of individuals and clones, as well as the comparison between only two distinct tissue types (LCLs and ACPs), have quantitative limitations. Our primary intent was to evaluate whether any I/SCs were shared between independently derived clonal datasets and to determine whether there is evidence of tissue-specific I/SC usage, rather than to make quantitative claims about global cell-type specificity.

      To address this concern, we will replace the hierarchical clustering analysis currently shown in Figure 1i with a Venn diagram that more directly illustrates the overlap and tissue-specific distribution of VERT regions detected in the different clonal sets. This revised representation avoids assumptions about clustering relationships and removes batch-driven bias, while still conveying the key observation that many VERT regions are shared across tissues and others appear tissue-restricted.

      While syntenic VERT regions across mouse and human are intriguing, they complicate interpretation of strong clustering by cell type. Sampling depth may also have exaggerated allelic imbalance calls.

      We note that the human LCLs used in our study are B cells, and immunoglobulin gene rearrangements were used to confirm the clonal uniqueness of each line. Similarly, the mouse replication timing data analyzed here was generated from pre-B cells, which also undergo immunoglobulin gene rearrangement. Thus, both the human LCL and mouse pre-B cell datasets were derived from B-cell lineages, providing a consistent cellular context for comparative analysis.

      Sequencing depth is an important consideration for all variant base calls. Without fully haplotype-resolved genomes, previous studies relied on calculating per-SNP calls of allelic imbalance based on reads covering a single nucleotide locus. To improve sequencing depth supporting the identification of VERT and AEI regions, we utilized fully haplotype-resolved genomes that allowed all informative allele-specific reads to be pooled across all heterozygous SNPs within genomic windows or expressed genes. For AEI, we set a minimum threshold of 20 informative allele-specific reads per gene, a minimum FDR-corrected p-value of <=0.05, and a minimum of 80% vs 20% allelic imbalance. Importantly, a recent study has shown that allelic imbalance as low as a 65%/35% is enough to effect disease penetrance in humans (Nature 2025; 637:1186–1197). We reiterate that more stringent thresholds (>90% and >95% imbalance) are presented in Supplementary Table 2.

      Gene set enrichment analysis should be restricted to avoid inflated significance from overly broad categories.

      Reviewer #2:

      Some of the GO terms presented are too broad to suggest any biological significance to the result, even if there is statistical significance (for example, the top term for LCL clones 'Cytoplasm' is associated with 12,000 genes, and the second term for mouse clones 'Membrane' is associated with 10,000). It would be helpful to focus on GO terms lower in the GO hierarchy.

      We will include our complete Gene Ontology analysis, with more specific biological categories, in Supplemental Table 5.

      Allelic imbalance has been referred to as AI, MAE (monoallelic expression), RMAE (random monoallelic expression) etc. The paper whose mouse data the authors make use of uses Asynchronous Stochastic Replication Timing (ASRT) instead of VERT to refer to the same phenomenon. Creating unnecessary jargon makes the paper more difficult to read and adds needless complexity to an already complex field.

      While we agree that allelic expression imbalance has been described by different investigators using many different phrases, we believe that MAE, RMAE and AI do not represent an accurate description of the phenomenon. In our study [and our previous study; Nat Commun. 2022; 13(1):6301] we used clonal analysis of allele-specific expression and found that while some clones display equivalent levels of expression between alleles of a given gene (i.e. bi-allelic expression) other clones express only one allele (i.e. mono-allelic expression), and yet other clones have undetectable expression (i.e. silent on both alleles). This pattern of allele-restricted expression indicates that each allele independently adopts either an expressed or silent state. Importantly, because these expression states are mitotically stable, allele-autonomous, and independent of parental origin, we refer to the choice of the expressed allele as stochastic. Given this variability, we believe that the phrase “Allelic Expression Imbalance” (AEI) represents a more accurate descriptor for this phenomenon. We also point out that “Allelic Expression Imbalance” has been used >120 times in the Pubmed database.

      In addition, the replication asynchrony that exists at these loci is not consistent with purely ASynchronous Replication Timing (ASRT) between alleles. We found that each allele can independently adopt either earlier or later replication timing in different clones. This variability results in some clones exhibiting pronounced asynchrony between alleles, while in others, the two alleles replicate synchronously, with both adopting either the earlier or later timing state. As reported in our previous study (Nat. Commun. 2022; 13:6301), this behavior reflects a stochastic and allele-autonomous process, leading us to describe these loci as exhibiting Variable Epigenetic Replication Timing (VERT), which we believe is a more accurate descriptor of this phenomenon.

      The point that allelic imbalance is enriched in VERTs would be enhanced if the authors could present the allelic ratio for all genes found in all VERTs, demonstrating how replication timing on either chromosome affects the allelic ratio.

      The stochastic nature of allelic expression and replication timing observed at VERT loci indicates that each allele independently acquires its epigenetic state. Specifically, the expressed or silent status of one allele does not predict the replication timing or expression status of the opposite allele. Accordingly, the Early/Late pattern of replication timing that we detect, both in this study and in our previous work (Nat. Commun. 2022; 13:6301), is not correlated with which allele is transcriptionally active. This supports our conclusion that asynchronous replication timing is not a downstream consequence of monoallelic transcription, but rather an independent epigenetic feature of I/SCs. Regardless, we will provide the combined expression ratios for all transcripts that are located within the VERT regions in a Supplemental Table.

      In addition, our analysis of imprinted loci reveals that even at genomic regions with parent-of-origin–specific expression, replication timing does not align with allelic activity: both early- and late-replicating alleles can be transcriptionally active, depending on the gene. This observation is consistent with the complex organization of many imprinted domains, where genes on opposite alleles exhibit reciprocal expression patterns. To illustrate this point, we will include a new supplemental figure demonstrating that imprinted loci harbor genes expressed from both the earlier- and later-replicating alleles.

      Figure 3 highlights the association of related gene clusters with VERTs but the VERTs are assigned based on variable replication timing in just 1 or 2 clones. This is an interesting observation, but to make the point that "VERT regions frequently coincide with gene clusters in the human genome" there needs to be a systematic assessment of replication timing at all gene clusters across all clones, and a statistical test for significance.

      Our intent in Figure 3 was not to suggest that all gene clusters are subject to VERT and AEI, but rather to highlight that several well-characterized multigene families that are known to exhibit random AEI, such as olfactory receptor and HLA gene clusters, coincide with VERT regions at their genomic locations. These examples serve as representative illustrations demonstrating that I/SC-associated regulation occurs at established AEI loci organized in gene clusters.

      To clarify this point, we will revise the text to explicitly state that Figure 3 presents illustrative examples of known AEI-associated gene clusters overlapping with VERT regions, rather than a comprehensive or statistically exhaustive analysis of all gene clusters across the genome.

      It is an interesting hypothesis that VERTs are conserved between species at synentic loci. If such regions are really conserved, one would expect that replication timing at these sites would be consistently asynchronous. However the data presented shows that in human clones these VERTs can be specific to an individual donor (as in 5A) or an individual clone (as in 5H).

      As discussed in our Limitations section, our analysis was restricted to a limited number of cell types, clones, and individuals, which may not capture the full diversity of I/SC usage across tissues and populations. While our dataset was sufficient to identify robust patterns of AEI and VERT, it likely represents only a subset of the broader landscape of I/SC regulation in both humans and mice. We anticipate that future studies incorporating a wider range of tissues, individuals, and clonal analyses will uncover an even greater degree of conservation and diversity in I/SC usage across genomes.

      In order to support the claim that neurodevelopmental disease associated genes reside in asynchronously replicating regions, and are thus more prone to allelic imbalance, the authors would need to demonstrate this phenomenon in neuronal cells.

      We make two points that address this critique: First, many of the neurodevelopmental disease genes located within or adjacent to VERT regions are not exclusively expressed in neuronal cells and have already been shown to exhibit AEI in non-neuronal contexts. For example, Gimelbrant and Chess (Science, 2007; 318:1136–1140) demonstrated AEI of the Parkinson disease genes SNCA and LRRK2 in lymphoblastoid cell lines (LCLs), and in our previous study, we detected AEI of DNAJC6, another Parkinson disease gene, in LCL cells (Nat. Commun. 2022; 13:6301). In the present study that used ACP cells, we identified VERT and AEI of several epilepsy-associated genes, including SCN1A, SCN2A (Fig. 6b), GABRA1(Fig. 6e), and SAMD12 (Fig. 6j), as well as a gene implicated in autism and neurodevelopmental disorders, SEMA5A (Fig. 5c).

      Second, independent studies from the E. Heard laboratory have provided further evidence that AEI occurs in neuronal lineages. Using mouse neural progenitor cells (NPCs), they identified genes subject to AEI (Dev. Cell, 2014; 28:366–380) and they later evaluated AEI of syntenic human neurodevelopmental disease genes, including Snca, App, Eya4, and Grik2 (Nat. Commun. 2021; 12:5330). In addition, they used the phrase “Allelic Expression Imbalance” to describe the epigenetic expression biases at these genes.

      Together, these findings reinforce that AEI, and by extension I/SC regulation, is not restricted to specific cell types, but rather represents a generalizable mechanism of stochastic epigenetic regulation that includes genes relevant to neurodevelopment and disease.

      However, the authors consistently lean on thin evidence (i.e. a single clone) within a modestly sized dataset (4 clones from 2 donors each) to propose a new model for haploinsufficiency in human disease. The consistent focus on limited elements in the data and perhaps an overreach in the interpretation makes it difficult to appreciate what is in fact a very good experiment.

      We agree that our analysis was conducted on a modest number of clones and individuals, which we explicitly acknowledge as a limitation of the present study. However, several key points support the robustness and broader relevance of our conclusions:

      i. Clonal Design and Replication: The strength of our approach lies in its clonal resolution. Each clone represents a single-cell–derived population expanded to over a million cells, enabling direct detection of stable, mitotically heritable allele-specific epigenetic states that would not be apparent in population-averaged data. Importantly, many of the VERT regions we identified are shared between independent clones from different donors and across distinct cell types (ACP and LCL), demonstrating reproducibility and biological consistency.

      ii. Cross-Species Validation: We further identified syntenic VERT regions in mouse pre-B cell clones, including at loci known to exhibit AEI in prior studies, providing independent validation and evolutionary conservation of the phenomenon.

      iii. Integration with Published Evidence: Our findings extend prior observations of AEI and variable replication timing (e.g. Gimelbrant et al. Science 2007; Heskett et al. Nat. Commun. 2022) and are fully consistent with known stochastic allelic expression imbalance of autosomal genes. We also draw parallels with the absence of cellular selection mechanisms that dictate dominant inheritance patterns for loss of function alleles for X linked disease genes (reviewed in: J Clin Invest, 2008, 20-23; and Nat Rev Genet. 2025, 26, 571–580). Our proposed model linking I/SC regulation to haploinsufficiency is therefore a synthesis of our results with an extensive body of published data, not an inference drawn from isolated observations.

      iv. Scope and Framing: We will revise the manuscript to clarify that our proposed model represents a mechanistic framework, not a definitive or exclusive explanation, for how stochastic allelic regulation could contribute to dosage-sensitive disease phenotypes. We will also explicitly discuss the need for larger datasets and additional tissues to refine and test this model.

      In summary, while we recognize the limited sampling inherent to clonal analyses, the consistency of our observations across donors, cell types, and species, together with prior corroborating studies, supports the validity of the conclusions and justifies the broader conceptual implications.

      Description of analyses that authors prefer not to carry out

      Reviewer #1:

      Cell-type specificity and mitotic stability both require stronger evidence; the latter is inferred indirectly from clonal expansion rather than shown directly, and orthogonal experiments (e.g., allele-specific ChIP-seq, DNA methylation) would be required.

      We disagree with this reviewer that the mitotic stability of the epigenetic states are “inferred indirectly from clonal expansion rather than shown directly”. Our experimental design inherently captures mitotically stable, allele-specific states because each clonal line is derived from a single progenitor cell and expanded to millions of cells before analysis. The allele-specific replication timing and expression profiles observed in these clones therefore reflect epigenetic states that are stably inherited across many cell divisions, rather than transient or stochastic fluctuations. This approach was also validated in our previous study (Nat. Commun. 2022; 13:6301), where the same clonal strategy demonstrated stable allele-restricted replication and expression patterns over extended passages.

      We agree that orthogonal assays such as allele-specific ChIP-seq or DNA methylation analyses would provide additional mechanistic detail on the nature of I/SC-associated regulation. However, these experiments fall outside the scope of the present study, which was designed specifically to identify and map autosomal loci that exhibit coordinated AEI and VERT, the defining epigenetic features of I/SCs. While we fully acknowledge that defining the precise molecular marks (e.g., histone modifications, DNA methylation, chromatin accessibility) that underlie I/SC regulation will be an important future direction, our current data provide a genome-wide, allele-resolved foundation upon which such mechanistic studies can build.

      In summary, the current dataset achieves the central goal of defining the genomic distribution and conservation of I/SCs based on functional readouts of replication timing and expression. Future work will extend these findings using allele-specific epigenomic profiling to characterize the epigenetic modifications associated with I/SC stability and cell-type specificity.

    1. eLife Assessment

      This manuscript reports the development and characterization of iGABASnFR2, a genetically encoded GABA sensor that demonstrates substantially improved performance compared to its predecessor, iGABASnFR1. The work is comprehensive and methodologically rigorous, combining high-throughput mutagenesis, functional screening, structural analysis, biophysical characterization, and in vivo validation. The significance of the findings is fundamental, and the supporting evidence is compelling. iGABASnFR2 represents a notable advance in GABA sensor engineering, enabling enhanced imaging of GABA transmission both in brain slices and in vivo, and constitutes a timely, technically robust addition to the molecular toolkit for neuroscience research.

    2. Reviewer #1 (Public review):

      Summary:

      This manuscript by Kolb and Hasseman et al. introduces a significantly improved GABA sensor, building on the pioneering work of the Janelia team. Given GABA's role as the main inhibitory neurotransmitter and the historical lack of effective optical tools for real-time in vivo GABA dynamics, this development is particularly impactful. The new sensor boasts an enhanced signal-to-noise ratio (SNR) and appropriate kinetics for detecting GABA dynamics in both in vitro and in vivo settings. The study is well-presented, with convincing and high-quality data, making this tool a valuable asset for future research into GABAergic signaling.

      Strengths:

      The core strength of this work lies in its significant advancement of GABA sensing technology. The authors have successfully developed a sensor with higher SNR and suitable kinetics, enabling the detection of GABA dynamics both in vitro and in vivo. This addresses a critical gap in neuroscience research, offering a much-needed optical tool for understanding the most important inhibitory neurotransmitter. The clear representation of the work and the convincing, high-quality data further bolster the manuscript's strengths, indicating the sensor's reliability and potential utility. We anticipate this tool will be invaluable for further investigation of GABAergic signaling.

      Weaknesses:

      Despite the notable progress, a key limitation is that the current generation of GABA sensors, including the one presented here, still exhibits inferior performance compared to state-of-the-art glutamate sensors. While this work is a substantial leap forward, it highlights that further improvements in GABA sensor would still be highly beneficial for the field to match the capabilities seen with glutamate sensors.

    3. Author response:

      The following is the authors’ response to the original reviews

      Public Reviews:

      Reviewer #1 (Public review):

      Summary:

      This manuscript by Kolb and Hasseman et al. introduces a significantly improved GABA sensor, building on the pioneering work of the Janelia team. Given GABA's role as the main inhibitory neurotransmitter and the historical lack of effective optical tools for real-time in vivo GABA dynamics, this development is particularly impactful. The new sensor boasts an enhanced signal-to-noise ratio (SNR) and appropriate kinetics for detecting GABA dynamics in both in vitro and in vivo settings. The study is well-presented, with convincing and high-quality data, making this tool a valuable asset for future research into GABAergic signaling.

      Strengths:

      The core strength of this work lies in its significant advancement of GABA sensing technology. The authors have successfully developed a sensor with higher SNR and suitable kinetics, enabling the detection of GABA dynamics both in vitro and in vivo.

      This addresses a critical gap in neuroscience research, offering a much-needed optical tool for understanding the most important inhibitory neurotransmitter. The clear representation of the work and the convincing, high-quality data further bolster the manuscript's strengths, indicating the sensor's reliability and potential utility. We anticipate this tool will be invaluable for further investigation of GABAergic signaling.

      Weaknesses:

      Despite the notable progress, a key limitation is that the current generation of GABA sensors, including the one presented here, still exhibits inferior performance compared to state-of-the-art glutamate sensors. While this work is a substantial leap forward, it highlights that further improvements in GABA sensors would still be highly beneficial for the field to match the capabilities seen with glutamate sensors.

      We thank Reviewer 1 for the positive assessment. We agree that further improvements in GABA sensor performance remain desirable. We acknowledge this limitation and outline directions for future development in the Discussion paragraph beginning "There are several promising avenues that could be taken to further optimize iGABASnFR."

      Reviewer #2 (Public review):

      Summary:

      This manuscript presents the development and characterization of iGABASnFR2, a genetically encoded GABA sensor with markedly improved performance over its predecessor, iGABASnFR1. The study is comprehensive and methodologically rigorous, integrating high-throughput mutagenesis, functional screening, structural analysis, biophysical characterization, and in vivo validation. iGABASnFR2 represents a significant advancement in GABA sensor engineering and application in imaging GABA transmission in slice and in vivo. This is a timely and technically strong contribution to the molecular toolkit for neuroscience.

      Strengths:

      The authors apply a well-established sensor optimization pipeline and iterative engineering strategy from single-site to combinatorial mutants to engineer iGABASnFR2. The development of both positive and negative going variants (iGABASnFR2 and iGABASnFR2n) offers experimental flexibility. The structure and interpretation of the key mutations provide insights into the working mechanism of the sensor, which also suggest optimization strategies. Although individual improvements in intrinsic properties are incremental, their combined effect yields clear functional gains, enabling detection of direction-selective GABA release in the retina and volume-transmitted GABA signaling in somatosensory cortex, which were challenging or missed using iGABASnFR1.

      Weaknesses:

      With minor revisions and clarifications, especially regarding membrane trafficking, this manuscript will be a valuable resource for probing inhibitory transmission.

      We thank Reviewer 2 for the positive assessment. Regarding membrane trafficking, we appreciate the suggestion to test different trafficking motifs. While such optimization represents a valuable direction for future development, it was beyond the scope of the present study and not feasible with the available time and resources. A different imaging modality would be needed to assess membrane trafficking efficiency or membrane-restricted expression, as the images presented in the manuscript (Figure 2a) are wide-field epifluorescence images, which lack the axial resolution required to distinguish membrane-localized signal from cytosolic fluorescence.

      We expect that the current characterization of iGABASnFR2 will nevertheless provide a strong foundation for future efforts to optimize membrane targeting and expression using alternative trafficking strategies.

      Recommendations for the authors:

      Reviewer #1 (Recommendations for the authors):

      (1) We noted an interesting inconsistency in the response of iGABASnFR1 and iGABASnFR2 when expressed as purified protein versus in mammalian cells. Such discrepancies are not uncommon for proteins exhibiting different behaviors in E. coli versus mammalian expression systems. We appreciate the authors' diligent effort in performing screening within a neuronal context. Similarly, the stark difference between the absolute affinity in purified form (∼0.778 μM) and on-cell measurements (6.4 μM) warrants further discussion. The authors may consider commenting on these observations in the discussion section.

      We have revised the Discussion (lines 401-410 in the ‘Tracked Changes’ document) to address the discrepancy between measurements obtained with purified protein and those from expression on the neuronal surface. As noted by the reviewer, such discrepancies are common, and our revision is intended to convey our empirical experience with this phenomenon rather than to offer a definitive mechanistic explanation.

      One factor to appreciate is that, when on the surface of neurons, the sensor is tethered to the membrane by an additional 60 amino acids. In addition to altering the local chemical environment, membrane tethering could impose entropic or mechanical constraints on the sensor. These constraints may damp conformational motions that underlie ligand binding and fluorescence changes. Beyond this, the local environment experienced by a membrane-anchored sensor differs substantially from that of soluble protein. There are potential electrostatic and steric effects arising from the plasma membrane and extracellular matrix, as well as post-translational modifications associated with mammalian expression. These effects on sensor performance are not readily predictable in either magnitude or direction, as illustrated by iGluSnFR, which exhibits a higher apparent affinity when membrane-tethered than in soluble form (Aggarwal et al 2023). For these reasons, we place greater emphasis on neuronal measurements as the most informative indicator of in vivo sensor performance.

      (2) Although iGABASnFR2 fluorescence exhibits pH dependence, its response appears less pH-dependent compared to the first-generation sensor. To enhance clarity, we suggest plotting the normalized response of both sensors across different pH values. This visual representation would be highly informative for readers.

      Thank you - we have implemented this, now showing the (F_sat - F_apo)/F_apo response as a function of pH for all three sensors in Fig 4 fig. supp 3b. This visualization nicely illustrates that the apo-to-sat response of iGABASnFR1 is much more influenced by pH than either iGABASnFR2 or iGABASnFR2n, which we note on lines 252-253 of the ‘Tracked Changes’ document.

      (3) To provide a more comprehensive characterization of the sensors, we recommend including a quantification of the decay times for all three versions of the sensors in Figure 2, specifically after panel 2c.

      Thank you - we now provide this in Fig 2d.

      (4) For improved readability of Figure 3a, we suggest adding distinct labels for iGABASnFR1 and iGABASnFR2 with corresponding colors.

      Good suggestion - we matched the color of the backbones to the rest of the manuscript (orange and green). We also added labels on the figure to ensure clarity.

      (5) The GABA released by SAC cells in Figure 5 looks amazing! We propose a minor modification to the cartoon in Figure 5b: mirroring the image horizontally (left to right). Given that the subsequent panels (e, h, and k) set the preferred direction of SAC movement as rightward, the current cartoon in Figure 5b inadvertently suggests stronger inhibition by SAC-released GABA when the spot moves left. Mirroring the image would align the cartoon more accurately with the subsequent data representations.

      Thanks - this is a nice streamlining. We have implemented the change.

      Reviewer #2 (Recommendations for the authors):

      (1) As sensor performance differs substantially between purified protein and neurons, a summary table comparing key properties (e.g., EC50, ∆F/F <sub>ax</sub>, response amplitude to # of AP) across purified protein and neurons would be highly informative.

      We discuss differences in sensor performance between purified protein and neurons in the Discussion (lines 401-410 in ‘Tracked Changes document) and, for the reasons outlined there, consider neuronal measurements to be far more predictive of in vivo performance. We therefore chose not to include a summary table directly comparing purified protein and neuronal data, as this would risk over-emphasizing in vitro measurements that we view primarily as qualitative signposts rather than more directly informative indicators of functional performance.

      (2) The authors should comment on the observed differences in performance between purified protein and neuronal expression. Would HEK293 cell measurements serve as a better predictor of in vivo performance than in vitro titrations? Insights here would benefit future sensor development pipelines.

      We have revised the Discussion to address this point (lines 401-410 in the ‘Tracked Changes’ document). We often observe differences in sensor performance between purified protein measurements and cellular or in vivo contexts. In our experience, titrations in primary neurons provide a better predictor of in vivo performance than in vitro protein titrations, as they more closely reflect relevant cellular factors. We do not have direct evidence that expression in heterologous systems such as HEK293 cells is generally more predictive, although this seems plausible; however, predictions inevitably become less reliable as sensors are translated to fully in vivo conditions.

      (3) Improved membrane localization likely contributes to the enhanced sensitivity of iGABASnFR2 in neurons beyond changes in EC50. In Figure 2a, membrane trafficking appears suboptimal. The authors should explore alternative trafficking motifs (e.g., ER2, Kv2.1, or motifs from other sensors) to further improve the membrane expression and consider adding a second fluorescent protein for quantifying membrane-localized brightness.

      Figure 2a presents wide-field epifluorescence images, which lack the axial resolution required to distinguish membrane-localized signal from cytosolic fluorescence. We therefore do not consider this imaging modality suitable for assessing membrane trafficking efficiency or membrane-restricted expression.

      We appreciate the suggestion to test different trafficking motifs to attempt to better capture biological signals. While such optimization represents a valuable direction for future development, it was beyond the scope of the present study and not feasible with the available time and resources. We expect that the current characterization of iGABASnFR2 will nevertheless provide a strong foundation for future efforts to further optimize membrane targeting and expression using alternative trafficking strategies.

      (4) Figure 4 - Supplement 2: The apparent EC50 of iGABASnFR2 seems affected by buffer composition and the presence of high concentrations of unrelated compounds. The authors should comment on this.

      We thank the reviewer for raising this point. Upon closer inspection, the EC50 of iGABASnFR2 in Fig 4 Supp 2 is measured at 1.4 μM, while in Fig 4a it is 1.1 μM - these mean values are quite close to one another, and within the range of experimental variability we expect for experiments done weeks or months apart. What differs most noticeably in this dataset is the shape of the dose–response curve rather than the EC50 itself; the origin of this difference is currently unclear. We have revised the Results text (lines 226-231 in ‘Tracked Changes document) to clarify this point and to emphasize that the key observation of Fig. 4–figure supplement 2 is that none of the additional compounds tested substantially impair GABA binding, indicating that they do not act as strong non-competitive allosteric antagonists or inhibitors.

      (5) The negative-going variant, iGABASnFR2n, is introduced but only briefly characterized. Including additional data or even a conceptual use case would clarify its potential utility.

      We have modified the discussion to provide more examples of conceptual use cases, clarifying how such a sensor could indeed be highly impactful. The full passage is lines 372-387 in the ‘Tracked Changes’ document; to summarize: a key application of the negative-going sensor is detecting decreases in ‘GABA tone’, which plays a key role in setting the excitation-inhibition balance across brain circuits. Reductions in extrasynaptic GABA are a well-documented feature of several biologically important brain-state transitions, including arousal, experience-dependent plasticity, and stress-related modulation of inhibition, and iGABASnFR2n could be an important tool for investigating these processes.

    1. eLife Assessment

      In this important contribution, Yan and colleagues describe a powerful and compelling strategy to generate concatamers of the BK channel and their fusion constructs with the auxiliary gamma subunits, which allows exploring contributions of individual subunits of the tetrameric channel to its gating and the study of heteromeric channel complexes of defined composition. Distinct examples are presented, which illustrate great diversity in the stoichiometric control of BK channel gating, depending on the site and nature of molecular perturbations. The molecular approaches could be extended to other membrane proteins whose N and C termini face opposite sides of the membrane.

    2. Reviewer #1 (Public review):

      Summary:

      BK channels are widely distributed and involved in many physiological functions. They have also proven a highly useful tool for studying general allosteric mechanisms for gating and modulation by auxiliary subunits. Tetrameric BK channels are assembled from four separate alpha subunits which would be identical for homozygous alleles and of potentially five different combinations for heterozygous alleles Geng et al . (2023), (https://doi.org/10.1085/jgp.202213302). Construction of BK channels with concatenated subunits in order to strictly control heteromeric subunit composition had not yet been used because the N-terminus in BK channels is extracellular whereas the C-terminus is intracellular. In this new work, Chen, Li, and Yan devise clever methods to construct and assemble BK channels of known subunit composition, as well as to fix the number of γ1 axillary subunits per channel. With their novel molecular approaches, Chen, Li and Yan report that a single γ1 axillary subunit is sufficient to fully modulate a BK channel, that the deep conducting pore mutation L312A exhibited a graded effect on gating with each addition mutated subunit replacing a WT subunit in the channel adding an additional incremental left shift in activation, and that the V288A mutation at the selectivity filter must be present on all four alpha subunits in order to induce channel inactivation. Chen, Li, and Yan have been successful in introducing new molecular tools to generate BK channels of known stoichiometry and subunit composition. They validate their methods and provide three different examples of stoichiometric modulation by LRRC26, the selectivity filter, and the pore.

      Strengths:

      Powerful new molecular tools for study of channel gating are developed and validated in the study.

      Weaknesses:

      One example each of auxiliary, deep pore, and selectivity filter allosteric actions are presented, but this is sufficient for the purposes of the paper to establish their methods and present specific examples of applicability.

    3. Reviewer #2 (Public review):

      Summary:

      This manuscript describes novel BK channel concatemers as a tool to study the stoichiometry of gamma subunit and mutations in modulation of the channel. Taking the advantage of modular design of BK channel alpha subunit the authors connected S1-S6/1st RCK as two- and four-subunit concatemers and coexpressed with S0-RCK2 to form normal function channels. These concatemers avoided the difficulty that the extracellular N-terminus of S0 was unable to connect with the cytosolic C-terminus of the alpha or gamma subunit, allowing a single gamma subunit to be connected to the concatemers. The concatemers also helped reveal the required stoichiometry of mutant BK subunits in modulating channel function. These include L312A in the deep pore region that altered channel function additively with each additional subunit harboring the mutation, and V288A at the selectivity filter that altered channel function cooperatively only when all four subunits being mutated. These results demonstrate that the concatemers are robust and effective in studying BK channel function and molecular mechanisms related to stoichiometry. The different requirement of the gamma subunit and the mutations stoichiometry for altering channel function is interesting, revealing fundamental mechanisms of how different motifs of the channel protein control function.

      Strengths:

      The manuscript presents well designed experiments with high quality data, which convincingly demonstrate the BK channel concatemers and their utility. The results are clearly written.

      Weaknesses:

      This reviewer did not identify any major concerns with the manuscript.

      Editors' note: We thank you for addressing some of the concerns, adding clarifications and more complete discussions, including further details about experimental protocols. The revised version is significantly improved. Some concerns linger that the biophysical/structural mechanisms underlying the observed phenotypes remain unclear and in some ways are phenomenological. However, the current study is more about the methodology and the mechanisms underlying the stoichiometry dependent effects are perhaps left for a separate study, with more detailed exploration. Congratulations for the excellent work.

    4. Author response:

      The following is the authors’ response to the original reviews.

      Public Reviews:

      Reviewer #1 (Public review):

      Summary:

      BK channels are widely distributed and involved in many physiological functions. They have also proven a highly useful tool for studying general allosteric mechanisms for gating and modulation by auxiliary subunits. Tetrameric BK channels are assembled from four separate alpha subunits, which would be identical for homozygous alleles and potentially of five different combinations for heterozygous alleles (Geng et al., 2023, https://doi.org/10.1085/jgp.202213302). Construction of BK channels with concatenated subunits in order to strictly control heteromeric subunit composition had not yet been used because the N-terminus in BK channels is extracellular, whereas the C-terminus is intracellular. In this new work, Chen, Li, and Yan devise clever methods to construct and assemble BK channels of known subunit composition, as well as to fix the number of γ1 axillary subunits per channel. With their novel molecular approaches, Chen, Li and Yan report that a single γ1 axillary subunit is sufficient to fully modulate a BK channel, that the deep conducting pore mutation L312A exhibited a graded effect on gating with each addition mutated subunit replacing a WT subunit in the channel adding an additional incremental left shift in activation, and that the V288A mutation at the selectivity filter must be present on all four alpha subunits in order to induce channel inactivation. Chen, Li, and Yan have been successful in introducing new molecular tools to generate BK channels of known stoichiometry and subunit composition. They validate their methods and provide three examples of their use with useful observations.

      Strengths:

      Powerful new molecular tools for the study of channel gating have been developed and validated in the study.

      Weaknesses:

      (1) One example each of auxiliary, deep pore, and selectivity filter allosteric actions is presented, but this is sufficient for the purposes of the paper to establish their methods and present specific examples of applicability.

      We sincerely thank Reviewer #1 for the thoughtful and supportive evaluation of our work. We greatly appreciate the reviewer’s clear summary of the study and the recognition of the novelty and utility of our molecular concatemer strategy for controlling BK channel subunit composition and stoichiometry.

      We also appreciate the reviewer’s positive assessment that the three examples (auxiliary subunit modulation, deep pore mutation, and selectivity filter mutation) are sufficient to establish the method and demonstrate its applicability. We are encouraged that the reviewer found the new molecular tools to be powerful and well validated.

      We have no further changes to make in response to this review, but we are grateful for the reviewer’s constructive and encouraging comments.

      Reviewer #2 (Public review):

      Summary:

      This manuscript describes novel BK channel concatemers as a tool to study the stoichiometry of the gamma subunit and mutations in the modulation of the channel. Taking advantage of the modular design of the BK channel alpha subunit, the authors connected S1-S6/1st RCK as two- and four-subunit concatemers and coexpressed with S0-RCK2 to form normal function channels. These concatemers avoided the difficulty that the extracellular N-terminus of S0 was unable to connect with the cytosolic C-terminus of the gamma subunit, allowing a single gamma subunit to be connected to the concatemers. The concatemers also helped reveal the required stoichiometry of mutant BK subunits in modulating channel function. These include L312A in the deep pore region that altered channel function additively with each additional subunit harboring the mutation, and V288A at the selectivity filter that altered channel function cooperatively only when all four subunits were mutated. These results demonstrate that the concatemers are robust and effective in studying BK channel function and molecular mechanisms related to stoichiometry. The different requirement of the gamma subunit and the mutations stoichiometry for altering channel function is interesting, which may relate to the fundamental mechanism of how different motifs of the channel protein control function.

      Strengths:

      The manuscript presents well-designed experiments with high-quality data, which convincingly demonstrate the BK channel concatemers and their utility. The results are clearly presented.

      Weaknesses:

      This reviewer did not identify any major concerns with the manuscript.

      We sincerely thank Reviewer #2 for the careful reading of our manuscript and for the highly positive and supportive comments. We appreciate the reviewer’s detailed summary of our concatemer design strategy and its use in studying gamma subunit stoichiometry and mutation-dependent modulation of BK channel function.

      We are especially grateful for the reviewer’s recognition that the experiments are well designed, the data are of high quality, and the results demonstrate the robustness and utility of the concatemer approach. We also appreciate the reviewer’s thoughtful note on the mechanistic implications of the distinct stoichiometric requirements observed for the gamma subunit, L312A, and V288A.

      We are pleased that the reviewer identified no major concerns. We have no further changes to make in response to this review, and we thank the reviewer again for the positive evaluation.

      Recommendations for the authors:

      Reviewing Editor Comments:

      While the study presents a great methodological advancement, the phenomenological examples described could perhaps benefit from a little more mechanistic description/discussion. In particular, the functional effect of the V288A mutant is very novel. It could be useful to discuss whether this mutant impacts channel selectivity/conductance. It could be beneficial to also contrast the subunit dependence of V288A with that of the W434F mutant of the Shaker channel. In the latter, C-type inactivation gating is accelerated even when the mutant is present in a single subunit, which contrasts with the effect in V288A.

      We greatly appreciate the editor’s and reviewers’ thorough and constructive evaluation, and we have revised the manuscript accordingly.

      We added discussion with citation about the potential effect of V288A on selectivity (lines 348349). We also added the reported stoichiometric effects of mutations in Shaker and hERG1 channels on C-inactivation in discussion (lines 336-351). From these studies and our findings with V288A in BK channels, it is interesting to note that the stoichiometric effects of these mutations varies and those located near or within selectivity filter signature exhibited an all-or-none effect in both hERG1 and BK channels.

      The authors might also want to consider performing and showing immunoblots with the alpha_deltaM fragment co-expressed with the other channel fragments. Together with the GFP tag, this alpha_deltaM would perhaps be a ~90 kDa protein. It should be captured by anti-V5 IP and resolved on an SDS-PAGE gel (at least with the quad construct).

      We added supplemental data (Fig.1 – figure supplement 1) to show co-expression and co-IP of the α<sup>ΔM</sup>-GFP construct and a FLAG-tagged α<sub>M</sub> construct. The α<sup>ΔM</sup>-GFP displayed right size on SDS-PAGE. It is of note that the single unit α<sub>M</sub> construct tended to oligomerize even under denatured condition on SDS-PAGE.

      For Figure 4, providing details about the inter-pulse intervals and interpulse holding voltage would be helpful. I was not able to find this information in the methods or text.

      The inter-pulse intervals and holder voltage are now added in Fig. 4 legend (line 638).

      Reviewer #1 (Recommendations for the authors):

      (1) Submitted papers should have page numbers to facilitate reviewing.

      Both page and line numbers are added.

      (2) The designation of the various channel types, such as BKα and BKαM should be identical in the text and figures, so either drop BK in the text or add BK in the figures. Maybe drop BK in the text, as it is known that BK channels are the topic of this study.

      We appreciate the suggestion to be consistent in text and figures. We have dropped “BK” for “BKα<sub>M</sub>” throughout the text.

      (3) "Single Boltzmann fits of G-V curves" would be consistent with a homogenous channel population but do not necessarily suggest a single homogenous channel population of BK channels, as was shown by Geng et al. (2023) (https://doi.org/10.1085/jgp.202213302) where the G-V curve for simultaneous expression of five BK channel types with different V1/2s for each channel type was well approximated by a single Boltzmann function. The dogma that a single Boltzmann fit suggests one channel type needs to be reset. So wave a red flag here: whereas a single Boltzmann fit is consistent with a single channel type, it does not establish a single channel type nor even suggest a single channel type.

      We fully agree that a good Single Boltzmann fit doesn’t mean homogenous channel population. We have changed “suggesting” to “consistent with” (line 203) and “reflecting” to “agreeing with” (line 205).

      (4) Geng et al. (2023) demonstrated that the pore mutation G375R in BK channels gave a left shift in activation linearly related to the number of WT subunits replaced with mutant subunits. This should incremental shift in activation for G375R should be mentioned, as it is consistent with the incremental effects of the L312A deep pore mutation on activation as reported by the authors in their Figure 3D.

      We appreciate the pointing-out of this highly relevant publication. We have now included this reference and discussed together with L312A mutation (lines 309-313).

      (5) I went back and looked at the Lingle laboratory papers on the gamma subunit. An additional sentence or two on what the Lingle lab found and didn't find would be useful here for readers.

      In the Introduction, we have listed the Lingle lab’s findings and the limitations of their experimental methods that warrants the development of a concatenated construct method as proposed in this study (lines 84-88). We prefer to not discuss further in the Discussion as it will be redundant.

      (6) For the two examined mutations L312A and V288A, include in the Methods a 21 amino acid sequence for each mutation with the amino acid to be mutated (L or V) in the center, with beginning and end numbering at the beginning and end of each list. This will allow the reader/experimenter to readily locate the mutated residue on their BK amino acid sequences, which may have different numbering than U11058. Interestingly, for the so-called canonical sequence Q12791 · KCMA1_HUMAN that I found in UniProt starting with U11058, there is an L312, but I found no V288, but an F288. Am I doing this correctly? Do I have the correct sequence/isoform? The only sure way to identify an AA is with an extensive pre and post-sequence so that the chance of misidentification approaches zero.

      We verified that the listed Gene Bank IDs of U11058 for cDNA and AAB65837 for protein should point to the right sequences. In the section of Results, we have now included the peptide sequences of the selectivity filter signature motif and part of the S6 TM where V288 and L312A are located, respectively (lines 179 and 220).

      Reviewer #2 (Recommendations for the authors):

      The different stoichiometry of the gamma subunit and the mutations in regulating channel function raise important questions. For instance, what are the structural and energetic bases for their different stoichiometric requirements? Does the structure motif, such as the selectivity filter or deep pore, act as a unit? Or does a specific residue, such as V288 or L312, act individually to determine the different stoichiometric requirements? What molecular interactions are involved for these residues and subunit to influence the cooperativity among the four alpha subunits in channel function? Some of these questions are discussed in the manuscript, but it may help the readers to clarify what aspects of the mechanistic bases for the findings in this manuscript are known and what aspects remain to be studied.

      We agree that these are all important questions. We have now cited more previous studies on C-inactivation in other K<sup>+</sup> channels and on deep pore mutations in BK channels in terms of subunit stoichiometry (lines 336-351). The results appear to be consistent, suggesting shared properties among residues within the selectivity filter motif or among residues in deep pore region.

      Some minor comments are as follows.

      (1) Page 7, 2nd paragraph: "Page 2B" change to "Page 3B"? Also, "delay in deactivation" is not precise. The term "Delay" in channel kinetics has a specific meaning, and the use of this word here causes some confusion. The authors may want to delete "substantial delay in deactivation evident as a”.

      Corrected by changing Fig. 2B to Fig. 3B and deleting “a substantial delay in deactivation evident as” (line 191).

      (2) Page 9, 1st paragraph: "used in the voltage protocol used". Drop one of the instances of used".

      Corrected by deleting the first “used” (line 246).

      (3) Page 12, 1st paragraph: "Nonetheless, the tight inter-subunit cooperativity observed at the selectivity filter makes it a plausible candidate for serving as the activation gate, a property not yet demonstrated for the lower S6 segment." This seems to be an interesting idea. However, it is not clearly explained. The authors may want to clarify how the cooperativity is related to the activation gate.

      We have now added a sentence with citations to discuss the requirement of intersubunit cooperativity for an activation gate to function (lines 354-357).

      Other major changes: We updated immunoblot figures Fig1C and Fig2C for better presentation.

    1. eLife Assessment

      This fundamental study presents experimental evidence on how geomagnetic and visual cues are integrated in a nocturnally migrating insect. The evidence supporting the conclusions is compelling. The work will be of broad interest to researchers studying animal migration and navigation.

    2. Reviewer #1 (Public review):

      Summary

      The manuscript by Ma et al. provides robust and novel evidence that the noctuid moth Spodoptera frugiperda (Fall Armyworm) possesses a complex compass mechanism for seasonal migration that integrates visual horizon cues with Earth's magnetic field (likely its horizontal component). This is an important and timely study: apart from the Bogong moth, no other nocturnal Lepidoptera has yet been shown to rely on such a dual-compass system. The research therefore expands our understanding of magnetic orientation in insects with both theoretical (evolution and sensory biology) and applied (agricultural pest management, a new model of magnetoreception) significance.

      The study uses state-of-the-art methods and presents convincing behavioural evidence for a multimodal compass. It also establishes the Fall Armyworm as a tractable new insect model for exploring the sensory mechanisms of magnetoreception, given the experimental challenges of working with migratory birds. Overall, the experiments are well designed, the analyses are appropriate, and the conclusions are generally well supported by the data.

      Strengths

      • Novelty and significance: First strong demonstration of a magnetic-visual compass in a globally relevant migratory moth species, extending previous findings from the Bogong moth and opening new research avenues in comparative magnetoreception.

      • Methodological robustness: Use of validated and sophisticated behavioural paradigms and magnetic manipulations consistent with best practices in the field. The use of 5 min bins to study a dynamic nature of magnetic compass which is anchored to a visual cue but updated with latency of several minutes is an important finding and a new methodological aspect in insect orientation studies.

      • Clarity of experimental logic: The cue-conflict and visual cue manipulations are conceptually sound and capable of addressing clear mechanistic questions.

      • Ecological and applied relevance: Results have implications for understanding migration in an invasive agricultural pest with expanding global range.

      • Potential model system: Provides a new, experimentally accessible species for dissecting the sensory and neural bases of magnetic orientation.

      Weaknesses

      Overall, this is a strong study, and the authors have completed an excellent major revision that has undoubtedly addressed most major and minor issues. The remaining points below are minor recommendations, and I acknowledge that differences in opinion are always possible:

      (1) Structure and Presentation of Results

      • I recommend reordering the visual-cue experiments to progress from simpler conditions (no cues) to more complex ones (cue-conflict). This would improve narrative logic and accessibility for non-specialist readers. The authors have chosen not to implement this suggestion, which I respect, but my recommendation stands.

      (2) Ecological Interpretation

      • The authors should expand their discussion on how the highly simplified, static cue setup translates to natural migratory conditions, where landmarks are dynamic, transient, or absent. Specifically, further consideration is needed on how the compass might function when landmarks shift position, become obscured, or are replaced by celestial cues. Additionally, the discussion would benefit from a more consolidated section with concrete suggestions for future experiments involving transient, multiple, or more naturalistic visual cues.

      This point was addressed partially in one paragraph of the Discussion, which reads as follows:

      "In nature, they are likely to encounter a range of luminance-gradient visual cues, including relatively stable celestial cues as well as transient or shifting local features encountered en route. Although such natural cues differ from our simplified laboratory stimulus, they may represent intermittently sampled visual inputs that can be optimally integrated with magnetic information, with the congruency between visual and magnetic cues likely playing a key role in maintaining a stable compass response. Whether the cues are static or changing, brief periods without them may still allow the subsequent recovery of a stable long-distance orientation strategy. Determining which types of natural visual cues support the magnetic-visual compass, and how they interact with magnetic information, including how their momentary alignment or angular relationship is integrated and how such visual cue-magnetic field interactions may require time to influence orientation, together with elucidating the genetic and ecological bases of multimodal orientation, will be important objectives for future research."

      While this paragraph is informative, the wording remains lengthy, somewhat unclear, and vague. Shorter, clearer statements would improve readability and impact. For example:

      • How could moths maintain direction during periods when only the magnetic field is present and visual landmarks are absent?

      • Could celestial cues (e.g., stars) compensate, and what happens if these are also obscured?

      • What role does saliency play when multiple visual landmarks are present simultaneously?

      • How might a complex skyline without salient landmarks affect orientation?

      Including simple, concise sentences that pose concrete open questions and suggest experimental designs would strengthen the discussion without creating space issues. In my view, a comprehensive discussion of how the simplified, static cue setup relates to natural migratory conditions-where landmarks are dynamic, transient, or absent-would add significant value to the paper.

      (3) Methodological Details and Reproducibility

      • The lack of luminance level measurements should be explicitly highlighted.

      • The authors chose not to adjust figure legends by replacing "magnetic South" with "magnetic North." While I believe this would be more conventional and preferable, this is ultimately a minor stylistic issue.

      (4) Conceptual Framing and Discussion

      • Although the authors made a good attempt to explain the limitations of using an artificial visual cue, I believe there is room for a more explicit argument. For example, it could be stated clearly that this species is unlikely to encounter a situation in nature where a single, highly salient landmark coincides with its migratory direction. Therefore, how these findings translate to real migratory contexts remains an open question. A sentence or two making this point directly would strengthen the discussion.

      (5) Technical and Open-Science Points

      • Sharing the R code openly (e.g., via GitHub) should be seriously considered. The code does not need to be perfectly formatted, but making it available would be highly beneficial from an open-science perspective.

    3. Reviewer #2 (Public review):

      Summary:

      The work titled "Geomagnetic and visual cues guide seasonal migratory orientation in the nocturnal fall armyworm, the world's most invasive insect" provided experimental evidence on how geomagnetic and visual cues are integrated, and visual cues are indispensable for magnetic orientation in the nocturnal fall armyworm.

      Strengths:

      It has been demonstrated that the Australian Bogon moth could integrate global stellar cues with the geomagnetic field for long distance navigation. However, data are lacking for other insects. This study suggested that the integration of geomagnetic and visual cues may represent a conserved navigational mechanism broadly employed across migratory insects.

      Weaknesses:

      The visual cues used in the indoor experimental system designed by the authors may have some limitations in ecological relevance. The author may need more explanations on this experimental system.

      In the revised manuscript, the authors have added explanations in the discussion section. I am fine with the revision.

    4. Author response:

      The following is the authors’ response to the original reviews.

      Public Reviews:

      Reviewer #1 (Public review):

      Summary

      The manuscript by Ma et al. provides robust and novel evidence that the noctuid moth Spodoptera frugiperda (Fall Armyworm) possesses a complex compass mechanism for seasonal migration that integrates visual horizon cues with Earth's magnetic field (likely its horizontal component). This is an important and timely study: apart from the Bogong moth, no other nocturnal Lepidoptera has yet been shown to rely on such a dual-compass system. The research therefore expands our understanding of magnetic orientation in insects with both theoretical (evolution and sensory biology) and applied (agricultural pest management, a new model of magnetoreception) significance.

      The study uses state-of-the-art methods and presents convincing behavioural evidence for a multimodal compass. It also establishes the Fall Armyworm as a tractable new insect model for exploring the sensory mechanisms of magnetoreception, given the experimental challenges of working with migratory birds. Overall, the experiments are well-designed, the analyses are appropriate, and the conclusions are generally well supported by the data.

      Strengths

      (1) Novelty and significance: First strong demonstration of a magnetic-visual compass in a globally relevant migratory moth species, extending previous findings from the Bogong moth and opening new research avenues in comparative magnetoreception.

      (2) Methodological robustness: Use of validated and sophisticated behavioural paradigms and magnetic manipulations consistent with best practices in the field. The use of 5-minute bins to study the dynamic nature of the magnetic compass which is anchored to a visual cue but updated with a latency of several minutes, is an important finding and a new methodological aspect in insect orientation studies.

      (3) Clarity of experimental logic: The cue-conflict and visual cue manipulations are conceptually sound and capable of addressing clear mechanistic questions.

      (4) Ecological and applied relevance: Results have implications for understanding migration in an invasive agricultural pest with an expanding global range.

      (5) Potential model system: Provides a new, experimentally accessible species for dissecting the sensory and neural bases of magnetic orientation.

      Weaknesses

      While the study is strong overall, several recommendations should be addressed to improve clarity, contextualisation, and reproducibility:

      We thank Reviewer #1 for the positive and encouraging evaluation of our study. We appreciate the recognition of our work’s strengths and are grateful for the constructive feedback on the remaining weaknesses, which will guide and strengthen our revisions.

      Structure and presentation of results

      Requires reordering the visual-cue experiments to move from simpler (no cues) to more complex (cue-conflict) conditions, improving narrative logic and accessibility for non-specialists.

      Thank you for this thoughtful suggestion. While we appreciate the rationale for presenting results from simpler to more complex conditions, we kept the original sequence because it aligns with the logic of our study. Our initial aim was to determine whether fall armyworms use a magnetic compass integrated with visual cues, as shown in the Bogong moth. After establishing this phenotype, we then examined whether visual cues are required for maintaining magnetic orientation. We have also clarified in the Introduction that magnetic orientation in the Bogong moth relies on integration with visual cues, which provides readers with clearer context and improves the overall narrative flow.

      Ecological interpretation

      (a) The authors should discuss how their highly simplified, static cue setup translates to natural migratory conditions where landmarks are dynamic, transient or absent.

      Thank you for raising this important point. We agree that natural migratory environments provide visual information that is often dynamic, transient, or intermittently absent, in contrast to the simplified and static cue used in our indoor experiments. Our intention in using a minimal, static cue was to isolate and test the fundamental presence of magnetic–visual integration in fall armyworms under fully controlled conditions.To address the reviewer’s concern, we have added a brief note in the Discussion indicating that fall armyworms may encounter both static and dynamic luminance-based visual cues in nature, such as light–dark gradients created by terrain features or more stable celestial patterns. Although these natural cues differ from our simplified laboratory stimulus, they may similarly provide asymmetric visual structure that can be integrated with magnetic information. We also note that determining which natural visual cues support the magnetic–visual compass will be an important direction for future work.

      (b) Further consideration is required regarding how the compass might function when landmarks shift position, are obscured, or are replaced by celestial cues. Also, more consolidated (one section) and concrete suggestions for future experiments are needed, with transient, multiple, or more naturalistic visual cues to address this.

      Thank you for this constructive suggestion. We appreciate the reviewer’s point that additional consideration of how the compass might function under shifting, obscured, or celestial visual cues would strengthen the manuscript. Given the limited evidence currently available for this species, we have incorporated a concise and appropriately cautious discussion addressing these possibilities.

      Methodological details and reproducibility

      (a) It would be better to move critical information (e.g., electromagnetic noise measurements) from the supplementary material into the main Methods.

      Thank you for this helpful suggestion. In the revised manuscript, we have added the key electromagnetic noise measurements information to the main Methods section.

      (b) Specifying luminance levels and spectral composition at the moth's eye is required for all visual treatments.

      Thank you for this helpful comment. We have clarified in the Methods as well as the legend of Fig. S3 that both luminance levels and spectral composition were measured at the position corresponding to the moth’s head.

      (c) Details are needed on the sex ratio/reproductive status of tested moths, and a map of the experimental site and migratory routes (spring vs. fall) should be included.

      Thanks. We have added the reproductive status of the tested moths in the Methods, specifying that all individuals used were unmated 2-day-old adults.

      (d) Expanding on activity-level analyses is required, replacing "fatigue" with "reduced flight activity," and clarifying if such analyses were performed.

      Thank you for this comment. In this context, the term “fatigue” referred to the possibility that moths might gradually lose motivation or attention to orient when flying for an extended period in a simplified, artificial environment with limited sensory cues. Such a decrease in orientation motivation over time could, in theory, lead to a loss of individual orientation and consequently to the observed loss of group orientation. To test this possibility, we analyzed the orientation performance of each individual moth across different phases using the Rayleigh test. The r-value was used as a measure of individual directedness (higher r-values indicate stronger orientation). Our results showed that mean r-values did not differ significantly among the experimental phases (multiple comparisons, Table S2). This indicates that 25min measurement itself was not responsible for the loss of orientation. We did not perform a quantitative activity-level analysis in this study. However, as mentioned in Methods, flight activity was continuously monitored during the experiments by observing fluctuations in the pointer values on the experimental software, which corresponded to the moth’s rotational movements. If the pointer values remained unchanged for more than 10 seconds, the experimenter checked for wing vibrations by sound; if the moth had stopped flying, gentle tapping on the arena wall was used to stimulate renewed flight. Only individuals that maintained active flight throughout the experiment, with fewer than four instances of wingbeat cessation, were included in the analysis. We also mentioned that activity level analysis was not performed due to technical difficulties in the revised manuscript.

      Figures and data presentation

      (a) The font sizes on circular plots should be increased; compass labels (magnetic North), sample sizes, and p-values should be included.

      Thank you for this helpful suggestion. Regarding the compass labels and statistical reporting, our analysis provides significance levels as ranges rather than exact p-values; therefore, we clarified in the figure legends that the two dashed circles correspond to thresholds for statistical significance p = 0.05 and p = 0.01, respectively. Sample sizes are already indicated within each panel. To avoid visual clutter caused by displaying both magnetic North and South, we show only the magnetic South direction (mS) consistently across panels, which can improve readability.

      (b) More clarity is required on what "no visual cue" conditions entail, and schematics or photos should be provided.

      Thank you for this comment. In our study, the “no visual cue” condition refers to the absence of the black triangular landmark inside the flight simulator. To improve clarity, we have updated the legend of Fig. 4 to explicitly state this and have referred readers to the schematic in Fig. 1, which illustrates the structure of the flight simulator. These additions clarify what the “no visual cue” condition entails without requiring additional schematics.

      (c) The figure legends should be adjusted for readability and consistency (e.g., replace "magnetic South" with magnetic North, and for box plots better to use asterisks for significance, report confidence intervals).

      Thank you. Regarding the choice of compass labeling, we intentionally used magnetic South (mS) rather than magnetic North (mN) because the main population tested in our experiments represents the autumn migratory generation. During autumn, fall armyworms orient southward when visual and magnetic cues are aligned. Using magnetic South in the plots therefore provides a clearer representation of cue alignment in this season and avoids potential confusion when interpreting the combined visual–magnetic information.

      Conceptual framing and discussion

      (a) Generalisations across species should be toned down, given the small number of systems tested by overlapping author groups.

      Thank you for this valuable comment. In the revised manuscript, we have softened such statements in both abstract and maintext.

      (b) It requires highlighting that, unlike some vertebrates, moths require both magnetic and visual cues for orientation.

      Thank you for this helpful suggestion. We have added a sentence to the Discussion explicitly highlighting that, unlike some vertebrates capable of using magnetic information in the absence of visual cues, moths require the integration of both magnetic and visual cues for accurate orientation. This clarification emphasizes the distinct multimodal nature of compass use in migratory moths.

      (c) It should be emphasised that this study addresses direction finding rather than full navigation.

      Thank you for this important clarification. We have now made it explicit in the manuscript that our experiments address direction finding (i.e., orientation) rather than full navigation. This distinction is stated in both the Introduction and Discussion to clearly define the scope of the study.

      (d) Future Directions should be integrated and consolidated into one coherent subsection proposing realistic next steps (e.g., more complex visual environments, temporal adaptation to cue-field relationships).

      Thank you for this constructive suggestion. We agree that outlining realistic next steps is valuable. However, given the limited scope of the current data, we have only slightly expanded the existing forward-looking statements in the Discussion.

      (e) The limitations should be better discussed, due to the artificiality of the visual cue earlier in the Discussion.

      Thank you for this comment. We agree that the artificiality of the visual cue is an important limitation of the present study. Rather than extending speculative discussion, we have clarified this limitation in the revised Discussion and highlighted the key questions that future work must address.

      Technical and open-science points

      Appropriate circular statistics should be used instead of t-tests for angular data shown in the supplementary material.

      Thank you for this comment. We have addressed this point (Fig. S1) in the revised supplementary material.

      Details should be provided on light intensities, power supplies, and improvements to the apparatus.

      Thank you. Light intensities are reported as spectral irradiance measurements in Supplementary Materials, which provide full wavelength-resolved information for the illumination used, although a separate measurement of total illuminance (lux) was not performed. We have also added the requested information on the power supplies.

      The derivation of individual r-values should be clarified.

      Thanks. We have clarified in the revised manuscript.

      Share R code openly (e.g., GitHub).

      Thanks. We are in the process of organizing the relevant R code, but have not been able to upload it to GitHub before the current revision deadline. The code is available from the corresponding author upon request.\

      Some highly relevant - yet missing - recent and relevant citations should be added, and some less relevant ones removed..

      Thanks. We added one recent relevant reference to the revised manuscript.

      Reviewer #2 (Public review):

      Summary:

      This work provided experimental evidence on how geomagnetic and visual cues are integrated, and visual cues are indispensable for magnetic orientation in the nocturnal fall armyworm.

      Strengths:

      Although it has been demonstrated previously that the Australian Bogon moth could integrate global stellar cues with the geomagnetic field for long-distance navigation, the study presented in this manuscript is still fundamentally important to the field of magnetoreception and sensory biology. It clearly shows that the integration of geomagnetic and visual cues may represent a conserved navigational mechanism broadly employed across migratory insects. I find the research very important, and the results are presented very well.

      We thank Reviewer #2 for the positive and encouraging evaluation of our study. We appreciate the recognition of our work’s strengths.

      Weaknesses:

      The authors developed an indoor experimental system to study the influence of magnetic fields and visual cues on insect orientation, which is certainly a valuable approach for this field. However, the ecological relevance of the visual cue may be limited or unclear based on the current version. The visual cues were provided "by a black isosceles triangle (10 cm high, 10 cm 513 base) made from black wallpaper and fixed to the horizon at the bottom of the arena". It is difficult to conceive how such a stimulus (intended to represent a landmark like a mountain) could provide directional information for LONG-DISTANCE navigation in nocturnal fall armyworms, particularly given that these insects would have no prior memory of this specific landmark. It might be a good idea to make a more detailed explanation of this question.

      We appreciate the constructive feedback on the weaknesses, which will guide and strengthen our revisions. To address the reviewer’s concern, we have added a brief note in the Discussion indicating that fall armyworms may encounter both static and dynamic luminance-based visual cues in nature, such as light–dark gradients created by terrain features or more stable celestial patterns. Although such natural cues differ from our simplified laboratory stimulus, they may represent intermittently sampled visual inputs that can be optimally integrated with magnetic information, whether the cues are static or changing, and brief periods without them may still allow the subsequent recovery of a stable long-distance orientation strategy.

      Recommendations for the authors:

      Reviewer #1 (Recommendations for the authors):

      Major to Medium Suggestions

      (a) Reordering of Visual Cue Tests

      The manuscript currently presents cue-conflict experiments before the simpler "no visual cue" tests. For non-specialist readers, it would be more logical to start with the basic condition (no visual cues) and then move to progressively more complex ones. This provides a clearer and more logically sound narrative.

      For example, the results could first demonstrate that without visual cues, the moths fail to orient (both in darkness and uniform light), and then show that introducing a single salient cue (a triangle on the horizon) restores directed behaviour. This would help readers understand the logic of the progression and should be better integrated throughout the Results and Discussion.

      Thanks. We have responded this comment in Public Reviews.

      (b) Translating Key Findings to Realistic Scenarios (LL 333-344 or where suitable in Discussion, and mentioning that we utilised a reductionist principle first in Intro, but clearly articulated that it is very simplified)

      The main text (eg Discussion) should address how these findings translate to real-world conditions. The experimental design used a single, highly salient, and static cue, always aligned with the migratory direction. In nature, such a consistent landmark is unlikely-mountains or other features would shift position relative to the moth's trajectory as it flies.

      Key questions arise which need to be addressed:

      - How would the compass system adapt to changing landmark positions as the moth moves?

      - What happens when no landmarks are visible (e.g. over flat plains or cloudy nights)?

      - Would stellar or other cues take over in such cases? Your hypotheses, please.

      Addressing these points - and proposing specific future experiments (e.g. with transient or multiple visual cues)-would strengthen the ecological relevance of the findings and show a clear way forward.

      Thanks for your kind comments. We now explicitly state in the Introduction that our study employs a reductionist approach using a simplified visual environment to isolate magnetic-visual interactions. As the ecological questions raised by the reviewer cannot be addressed with the current dataset, we avoid extended speculation but have added brief clarification in the Discussion and addressed these points in the Public Reviews response. We also indicate that future work will need to examine the types of visual cues that can support magnetic orientation and how such cues couple with geomagnetic information.

      Technical and Methodological Points

      (a) Incomplete Methods Section

      Critical technical information (e.g. electromagnetic noise measurements) currently appears only in supplementary figure legends. All such details should be included in the main Methods section if the word count allows (or include a short section in the main text with reference to more details in the supplementary material).

      Thanks for your kind comments. We have addressed this as suggested in the Public Reviews.

      (b) Lighting Conditions

      Specify luminance levels (the amount of light emitted and passing through in quanta per unit of surface, eg m2) at the moth's eye and indicate whether spectral composition was consistent between treatments (with and without the visual cue).

      Thanks for your comments. We have responded to this point in the Public Reviews.

      (c) Figures

      - Increase font sizes on circular histograms.

      - Add compass labels (ideally magnetic North, mN, not south, etc, as it is usual in pertinent literature), sample sizes, and p-values on each panel.

      - Replace "magnetic South" (mS) indicators with magnetic North (mN) to align with convention.

      Thanks for your comments. We have responded to this point in the Public Reviews.

      (d) Migratory Expectations

      Include expected compass bearings for spring and autumn migrations (with citations) to relevant figures (Figure 2, 4, S2).

      Thanks for your comments. We have added the information that “We recently found that fall armyworms from the year-round range in Southwest China (Yunnan) exhibit seasonally appropriate migratory headings when flown outdoors in virtual flight simulators, heading northward in the spring and southward in the fall, and this seasonal reversal is controlled by photoperiod (Chen et al., 2023).” in Introduction. Thus, we didn’t offer expected seasonal compass bearings in Results section.

      (e) Add a map showing the experimental site and known migratory routes, clearly labelling spring vs fall routes. It would help justify expected headings.

      Thank you for this suggestion. At present, there are no experimentally validated migratory routes (e.g., through mark-release-recapture or tracking approaches) for the specific fall armyworm population used in our study. Because these routes have not been biologically confirmed, we didn’t offer a presumed migratory map that may imply unwarranted certainty.

      (f) Composition of Test Groups

      Indicate sex ratios and reproductive status (mated/unmated) of tested moths, if known or comment if unknown, as both can affect migratory motivation and behaviour.

      Thank you for this suggestion. We have responded to this point in the Public Reviews.

      (g) Role and Nature of Visual Cues

      While the results clearly show that orientation disappears without visual cues, the triangle cue is highly artificial. Well-studied Bogong moths are known to rely on views of Australian mountain ranges during their nocturnal migrations, but there is no evidence that armyworms use a similar strategy. Even for bogongs, it is not just one salient mountain always in front of them on migration. Discuss whether Fall Armyworm would encounter comparable natural cues in the field along their migratory route, or whether the triangle might simply provide a frame of reference rather than a true landmark.

      Thank you for this comments. We have responded to this point in the Public Reviews.

      (h) Future work could test:

      - More naturalistic sky cues (moonlight, star fields).

      - Varying the landmark's position relative to the magnetic field - slowly moving along - transient landmarks. Also, less salient landmarks and a more complex skyline, as it is usually more complex than just a single salient peak.

      Thank you for this comments. We have responded to this point in the Public Reviews. Brief discussion as suggested has been added to the revised manuscript.

      Minor Comments and Line-by-Line Suggestions

      L70 - Check citation (possibly Mouritsen 2018). Missing in the list of references.

      Thanks. This point has been addressed.

      L75 - Consider citing the new and highly relevant preprint:

      Pakhomov, A., Shapoval, A., Shapoval, N., & Kishkinev, D. (2025). Not All Butterflies Are Monarchs: Compass Systems in the Red Admiral (Vanessa atalanta). bioRxiv.

      Thanks. We have cited this reference.

      LL81-82 - Clarify vague phrasing; specify criteria for "good" vs "poor" orientation ability. Or reword/leave out.

      Thanks for your comments.

      L85 - "but one," not "bar one." 

      Thanks. Corrected.

      L124 - The 2 genetic citations are weakly linked to magnetoreception. We do not have a clear understanding of the insect magnetoreceptor and its underlying mechanism, so we simply cannot interpret genetic associations very well to underpin them to magnetoreception. For example, does noctuid's magnetic sense require a magnetised-based receptor and genes involved in biomineralization? Consider removing or softening claims. 

      Thanks. Adressed.

      LL123-126 - Define what for YOU constitutes "strong evidence" for magnetoreception (e.g. adaptive directional behaviour consistent with migratory orientation?). Is there such a thing as strong evidence at all?

      Thanks for your comments. We agree that terms such as “confirmed” or “strong evidence” can overstate the certainty of magnetoreception findings, given the ongoing debates in the field. In the revised manuscript, we have toned down.

      L153 - Indicate whether coils in NMF condition were powered or inactive.

      Thanks for your comments. Addressed.

      L163 - Justify use of multiple 5-min phases (e.g. temporal resolution of behaviour). It is confusing at the start, where first mentioned, and becomes clearer only towards the end, but it should be clearer at the start.

      Thanks for your comments. The assay was divided into these 5-min segments to provide the temporal resolution needed to detect changes in flight orientation as the relative alignment of magnetic and visual cues was systematically altered. We now clarify this earlier in the Results.

      LL167-171 - This is a good place where you can provide a map (main or supplementary with referencing) showing the study site and migration routes.

      Thanks for your suggestion. We have responded to this point in the Public Reviews.

      L174 - Avoid repetition of "expected."

      Thanks. Addressed.

      LL176-177 - Report 95% confidence intervals or equivalent and clarify which test (e.g. Moore's paired test) each p-value refers to.

      Thanks for your suggestion.

      LL189-191 - explain what fatigue means. I would remove fatigue and substitute it with "lowered flight activity". Also, the same statement comes later, so avoid repetitiveness and remove it in one place. The analysis of directedness is good throughout, but what about the analysis of activity level? Could you explain whether you did it or not, and if not, why, or if angular changes can serve as an activity proxy? Replace "fatigue" with "reduced flight activity." Avoid repetition. Clarify if activity level analysis was performed or if it was not, e.g. due to technical difficulties.

      Thanks for your comments. We have responded to this point in the Public Reviews.

      L196 - Note whether 95% CI overlaps with the expected direction. This is a crucial outcome.

      Thanks for your comments.

      LL203-205 - unclear, better to stick to "congruency", especially "initial congruency for the relationship between mN and visual cue" throughout.

      Thanks for your suggestions.

      L206 - Better to introduce a new subheading: "Laboratory-Reared Animals.".

      Thanks for your suggestion. A new subheading has been added in the revised manuscript.

      LL207-208 - Clarify which cues were available in Chen et al. (2023) and how they differ here.

      Thanks for your comments. In Chen et al. (2023), the moths oriented under an artificial starry sky together with optic flow cues. In contrast, our experiments intentionally removed both the starry-sky pattern and optic flow to avoid introducing additional visual information when testing magnetic-visual integration for orientation. We have added further clarification regarding the conditions used in Chen et al. (2023) in the revised manuscript.

      L228 - Use "lab-reared" consistently throughout the entire MS. Do not mix with lab-raised.

      Thanks. Addressed by consistently using “lab-raised”.

      Figure 2 - Confusing in parts, especially for people coming from birds and other vertebrates orientation background. At 12 o'clock, you usually expect either mN / gN (magnetic or geographic North) or the animal's own initial directional response used as control to compare the same animal's direction post-treatment. Here, your 6 o'clock is magnetic South in the first place - non-conventional. At 12 o'clock, better use mN or gN. Avoid using non-conventional references such as magnetic south. Remind readers of seasonally appropriate headings and refer to the map.

      Thanks. We have responded to this point in the Public Reviews.

      LL232-234 - Emphasize that cue-magnetic congruency is key. Highlight the most important point that the congruency between the seasonal migratory direction and visual cues is key, not that in spring/fall, visual cues must be towards or opposite to the migratory goal. But the visual cue could be in the migratory direction or opposite, or at an angle - this is for future direction.

      Thanks. We have responded to this point in the Public Reviews.

      Figure 2 and associated main text - highlight that you only tested the designs when in all seasons the salient and single visual cue was in the migratory direction (in spring it coincided with mN but in fall it was towards the magnetic south). Other directions of visual cues have not been tested, but for simplicity and consistency, you chose to do these ones as the first step, perhaps.

      Thank you for this insightful comment. Yes, our experiments tested only the conditions in which the salient and single visual cue was aligned with the migratory direction. Other angular relationships between visual cues and the magnetic field were not examined in this study. For simplicity and consistency, we focused on this alignment as a first step toward understanding magnetic-visual cue integration in migratory orientation. We now highlight this in the Fig. 2 legend.

      Figures captures/legends - hard to tell from the main text now, better to italicize figure caption text and visually space them from the main text.

      Thanks for your suggestions.

      LL 250-251 - mention to people more familiar with r - lowercase - what is the expected range for R uppercase. It is not bound 0-1 as r. Could it be negative? How large can it be?

      Thanks. Thanks for the comment. After revisiting Moore (1980) we think that R* cannot take negative values. However, since R* = R*/N^ (3/2), it is not bounded between 0 and 1. We didn’t find any concept of an upper bound in the paper (https://doi.org/10.2307/2335330).

      Figure 3 - Consider adding a horizontal line indicating the 5% significance threshold.

      Thanks for your suggestions.

      L 261 - need to have some narrative after the subheading before you insert Figure 3.

      Thanks. Addreseed.

      LL274-275 - highlight that the timeline of this congruency between mN and a landmark and the effect of this on directedness is not explored here, but worth doing in future. How long does a new congruency or a relationship between mN and a visual cue need to be exposed to the animal to regain its directional response? Clearly, it is just a question of time of exposure so that a new association is established. Suggest future work on time-dependent adaptation to new cue-field relationships.

      Thanks for your suggestion. We have now included this point as a future direction in the revised Discussion.

      Figure 4 & S4 - Replace letters with asterisks/brackets for significance. The use of the letter is confusing and unconventional.

      Thanks for your suggestion.

      Figure 4 caption - Clarify the main takeaway.

      Thanks for your suggestion.

      Figure 4 - bare minimum is confusing. I understand that you wanted to avoid "no visual cues" because, as long as the animal sees things, there are things to be used as visual cues, even if this is not the intention of the experimenter. However, it needs clarification and rewording. Better to be more specific, like "no black triangle and horizon were used, just the uniformly white cylinder", or something like that.

      Thanks for your comments. In our setup it accurately describes the intentional removal of both the black triangle and the horizon, leaving only the uniformly white cylinder as the visual environment. This wording was chosen to reflect the practical limitations of producing a perfectly symmetrical flight simulator under laboratory conditions, and we therefore prefer to retain the original phrasing.

      L328 - Remove Xu et al. (2021) citation (not relevant). This is an in vitro study with a protein which may not work exactly as it is claimed in the paper in vivo.

      Thanks. Citation removed.

      L349-350 - Clarify what "no visual cue" means (e.g., uniformly white cylinder, no horizon line). Include a photo or a schematic of the inner surface of the cylinder for this condition in the Supplementary Materials.

      Thanks. We have responded to this point in the Public Reviews.

      L380 & throughout - Replace "barely minimum visual cues" (BMVC) with "no visual cues", clarifying limitations in Methods, meaning that you can explain that absolutely no visual cues is practically impossible because, as long as there is light, animals can use some asymmetries as cues even if this is not the intention of the experimenter.

      Thank you for this comment. We have decided to retain the term “barely minimum visual cues (BMVC)” because it accurately describes our experimental condition, which is distinct from a true “no visual cues” environment. In the revised Figure legend, we now clarify that BMVC refers to conditions in which obvious visual cues (i.e., features such as the black triangle in Fig. 1) were removed, while acknowledging that complete elimination of all visual information is not possible under illuminated conditions.

      L396 - Be cautious when generalizing from two species tested by a research group that is not absolutely independent (some authors in bogong and armyworm works overlap). We saw examples in diurnal migratory butterflies (Monarchs), a more studied species than the armyworm, that the findings do not entirely translate to Red Admirals (Pakhomov et al. 2025 preprint mentioned). Suggestion to tone down any claims of broad generalisation throughout the manuscript.

      Thank you for this comment. We have responded to this point in the Public Reviews.

      LL402-407 - Note that, unlike birds (e.g. European robins), moths appear to require both magnetic and visual cues for orientation, whereas birds, mole rats and some other animals can use magnetic cues alone.

      Thank you for this comment. We have responded to this point in the Public Reviews.

      L410 - Specify that this is correct only in the Northern Hemisphere.

      Thank you for this comment. Addressed.

      LL415-416 - Acknowledge artificiality of single-cue setup (see the major comments above); integrate earlier in the Discussion.

      Thank you for this comment. We have responded to this point in the Public Reviews.

      LL420-425 - Consolidate Future Directions into a single subsection; include more concrete experimental ideas, for example, using more naturalistic, numerous transient landmarks (could be done in a virtual maze with LEDs on the wall of the cylinder with cues moving with time). Multiple visual cues. Manipulating with salience of cues - less simplistic, less salient.

      Thank you for this comment. We have responded to this point in the Public Reviews.

      L431 - Does this paper support this statement? I think it just tested the use of stellar cues in a zero magnetic field. It also dealt with direction finding, not navigation, which is a position-finding ability - a much more complex feat and might not be the ability of moths (requires further studies like with geographic and magnetic displacements, etc). Reword and check this. Show the distinction between direction finding and navigation.

      Thank you for this comment. We have reworded the relevant sentence to use “orientation” instead of “navigation”.

      L436-437 - Specify "global visual cues" (stellar, lunar, etc.) and merge all future directions into one coherent section.

      Thank you for this comment. Addressed.

      LL443-446 - A bit early to plan such studies because migratory direction could well be a complex multigenetic trait, so that you cannot approach it simply with the knock out of a single gene. The genetic basis of magnetic direction needs to be first demonstrated, which leads you to the Future Directions section.

      Thank you for this helpful comment. We fully agree that migratory direction is likely a complex multigenic trait, and our intention was not to imply that knocking out a single gene would be sufficient to explain magnetic or migratory orientation. Our statement aimed only to highlight that identifying candidate genes is an important first step toward understanding the genetic basis of magnetic orientation.

      Line 496 - Clarify whether optic flow was used (unlike previous studies).

      Thank you for pointing this out. Clarified.

      LL499-511 - Clarify the improvements done in Chen's system and their relevance.

      Thank you for pointing this out. We reworded this sentence “The Flash flight simulator system was developed based on the early design of the Mouritsen-Frost flight simulator and adapted for our experiments in Yuanjiang”.

      Line 531 - Report and compare light intensities between indoor and outdoor experiments.

      Thanks for this comment. Unfortunately, due to the sensitivity limits of our current equipment, we were unable to reliably measure outdoor light intensities at night. However, we did not perform any open-top outdoor flight-simulator experiments; instead, we used field-captured moths but conducted all behavioral tests indoors.

      L549 - Add make/model of power supplies.

      Thanks. Addressed.

      LL582-585 - Specify whether R code will be shared; recommend open access (e.g., GitHub, other open repositories). Reiterate the importance of open science and sharing all scripts. Also here, add citations to some studies where MMRT has been used recently.

      Thank you for this comment. We have responded to this point in the Public Reviews.

      Line 592 - Explain how individual r-values were derived from optical encoder data.

      Thank you for this comment. Addressed.

      L842-843 - t-tests are inappropriate for angular data; use circular tests (Watson-Williams, Mardia-Watson-Wheeler, etc.).

      Thank you for this comment. Addressed.

      L865 - Reword to avoid repetition of "fall." Example: "In field captured armyworms during fall migration".

      Thank you for this comment. Addressed.

      LL882-885 - Improve phrasing and language here. Confirming that - no colon after. "Both the acrylic plate and diffusion paper." Confirm relevance of spectra to moth visual sensitivity - add relevant citation to original studies showing that.

      Thank you for this comment. Addressed.

      L886 - Reword "uniform" - does not look uniform to me.

      Thank you for this comment. Addressed.

      Reviewer #2 (Recommendations for the authors):

      The first two sentences of the abstract ("The navigational mechanisms employed by nocturnal insect migrants remain to be elucidated in most species. Nocturnal insect migrants are often considered to use the Earth's geomagnetic field for navigation, yet the underlying mechanisms of magnetoreception in insects remain elusive") are somewhat redundant. The authors may consider rewriting them.

      Thank you for pointing this out. We have rewritten this opening to provide a more concise and non-repetitive introduction.

    1. eLife Assessment

      Laaker et al. make an important finding that the cribriform plate acts as a unique neuroimmune interface that shapes local myeloid cell states during EAE-induced neuroinflammation. Using immuohistochemistry, flow cytometry, and single-cell RNAseq of doublets to interrogate cell-cell interactions, the authors provide solid evidence that macrophages, migratory dendritic cells (DCs), and fibroblasts interact at the site of CSF outflow, with DCs showing characteristics of immune tolerance. While the functional consequences of these cell states remain to be established, the work shows that the cribiform plate can play a key role in influencing immune cell composition and interactions with stromal cells.

    2. Reviewer #1 (Public review):

      Summary:

      Laaker et al. investigate the immunological role of the cribriform plate during neuroinflammation using the EAE model. The authors combine immunohistochemistry, flow cytometry, and single-cell RNA sequencing to characterize CD11b+CD11c+ myeloid cells that accumulate at podoplanin (PDPN)-rich meningeal-lymphatic niches surrounding olfactory nerve bundles. They identified distinct populations of migratory dendritic cells (DCs) and macrophages retained at the cribriform plate that exhibit transcriptional signatures consistent with immune tolerance, reduced interferon signaling, and programmed cell death, including Pdcd1 (PD-1) expression. In parallel, CCR2+ monocytes and alternatively activated (M2-like) Arg1+/CHI3L3+ macrophages integrate into this niche, suggesting the establishment of a locally immunosuppressive myeloid network.

      Strengths:

      (1) Overall, the study postulates a novel model in which the cribriform plate functions as a specialized perineural immune interface that reshapes myeloid phenotypes during neuroinflammation.

      (2) Suggests broader relevance for shaping peripheral immunity and therapeutic targeting. If DCs are being "tuned" at this exit site, it could influence what reaches cervical lymph nodes and how peripheral responses are set during CNS autoimmunity; the authors explicitly position this as relevant to CNS autoimmunity and possibly other CNS diseases (while acknowledging the need for human validation).

      (3) Technical sound and highly original work. Convergent multi-method support: the central narrative is backed by immunohistochemistry + flow cytometry + scRNA-seq, rather than a single assay. The headline conclusion (tolerogenic/suppressive skew at the cribriform plate during EAE) is explicitly built from these combined modalities.

      Weaknesses:

      (1) In Figure 1, the manuscript would be strengthened by quantification of CSF1R-GFP+ and CD11c-eYFP+ cells in PDPN+LYVE1- versus PDPN+LYVE1+ regions in both control and EAE mice. This would demonstrate selective accumulation or retention of myeloid cells at the cribiform plate niche.

      (2) While the PostContact-seq strategy is innovative (Figure 3), additional justification is needed to demonstrate that tissue dissociation did not artificially disrupt PDPN-myeloid contacts. The relatively small proportion of live PDPN-rich doublets (~2.5% total aggregates and ~18% PDPN+ within total aggregates) raises questions about representativeness compared with in situ observations. The authors should also more explicitly elaborate on why PostContact-seq was favored over alternative approaches such as PIC-seq.

      (3) The authors stated that results regarding cell-cell interactions were integrated across four intercellular communication methodologies (Figure 4B), but this integration is not clearly described in either the Results or Method sections. This needs clarification. Moreover, the interaction analysis in Figure 4B seems to rely on TALKIEN, which does not incorporate prior ligand-receptor knowledge. Given the availability of widely used tools, such as CellChat and NicheNet, the authors may consider cross-referencing their findings.

      (4) Given the increase in CCR2+ cells in PDPN+ regions (Figure S4), a pseudotime trajectory analysis may be valuable to test whether CCR2+ monocytes preferentially differentiate into CHI3L3+ immunosuppressive macrophages, PD-1+ DCs, or other myeloid subsets in post-contact versus no contact.

      (5) Validation of immunosuppressive signatures in macrophages (Fig. 4G-H) using the same FACS-based post-contact versus no-contact sorting strategy (as in Figure 3A) would strengthen the conclusions.

      (6) The identity of CD45IV+ cells in contact with PDPN+ cells is unclear (Figure 6B-C). The authors should provide a gating strategy demonstrating that these cells are CD11b+CD11c+ DCs within the PDPN+ doublet population, and ideally show whether these dying cells are PD-1+. Furthermore, co-labeling in tissue sections for PD-1, cleaved caspase-3, and CD11c-eYP would provide important spatial validation of flow cytometry findings (Figure 6E).

      (7) In Figures 1F-H, the authors should comment on the morphological differences of CD11c+ cells in the olfactory bulb versus those infiltrating the cribriform plate.

    3. Reviewer #2 (Public review):

      Summary:

      In this article, Laaker et al described diverse populations of macrophages and dendritic cells found in and around the cribriform plate in the context of a neuroinflammation caused by an autoimmune disease (EAE). The authors utilize elegant histochemical staining and a nifty approach to sort doublets to interrogate cells that are in contact with one another, presumably in vivo. Notably, they uncover a population of CD11c+CD11b+ cells interacting with M2 macrophages and PDPN+ fibroblasts and lymphatics. These cells are heterogenous but some of these DCs express PD-1, and transcriptional profiling suggests they may have immunosuppressive behavior. Altogether, this article explains well the complexity of cell populations found around the cribriform plate during inflammation, and is suggestive of different interactions that trigger these different phenotypes from immune cells.

      Strengths:

      Beautiful images of a unique CNS: peripheral interface that support a novel scRNA approach to understanding how different cell populations engage in functional interactions in vivo.

      Weaknesses:

      It's currently unclear how the sorted populations reflect in vivo interactions or a propensity to form aggregates during ex vivo processing. The authors address both podoplanin-expressing cells as stromal cells and as lymphatic endothelial cells, but at times it's unclear which of these two populations is being analyzed and which is the most relevant. While novel observations, most of these findings are descriptive and lack functional correlates, and in places, the potential implications could use further discussion.

    4. Author response:

      We would like to thank the reviewers for their supportive comments which largely agree with our main finding that a heterogeneous population of dendritic cells and Th2-skewed macrophages interact with the PDPN+ niche at the cribriform plate during EAE neuroinflammation. Additionally, they have provided several meaningful critiques to our study which we are now working on addressing in a newly revised manuscript.

    1. eLife Assessment

      In this valuable study, DNA and RNA are co-imaged in single cells to show that the proximity of topologically associated domain (TAD) boundaries is uncoupled from the transcriptional activity of nearby genes. The evidence supporting these conclusions is convincing for the regions examined, with high-throughput imaging providing robust statistics. This work will be of interest to researchers studying genome architecture and its relationship to gene regulation.

    2. Reviewer #1 (Public review):

      Summary:

      This is an important study that employs high-throughput single-cell imaging to directly investigate the relationship between topologically associating domain (TAD) boundaries and gene regulation. The authors rigorously test the prevailing model that TAD boundaries functionally regulate gene activity by modulating chromatin interactions. Their core finding is that, under their specific experimental conditions, the physical distance between TAD boundaries shows no consistent correlation with the transcriptional bursting activity of a gene within the TAD. However, the authors' leap from this specific observation to the broad conclusion that "TAD boundary architecture and gene activity are uncoupled" risks conceptual overgeneralization and may lead to misinterpretation, as it seemingly contradicts substantial prior evidence supporting the regulatory role of TAD structures.

      Strengths:

      The major strength of this work lies in its innovative high-throughput, multi-colour imaging platform, which enables the simultaneous detection of spatial distances between specific DNA elements (TAD boundaries) and transcriptional activity at the same genomic locus in single cells and single alleles. The high-throughput nature makes the results convincing. A second key strength is the incorporation of perturbations, including global transcriptional inhibition, cell-type comparison, and degradation of key architectural proteins (CTCF, cohesin). This provides a comprehensive methodological framework to examine the relationship between boundary proximity and gene activity from multiple angles under defined conditions.

      Weaknesses:

      (1) Conceptual framing and interpretation:

      The central conclusion may require more precise framing to avoid potential overreach. The authors' interpretation equating "physical distance between TAD boundaries" with overall "TAD boundary architecture," and "transcriptional bursting events" with broader "gene activity," could benefit from clarification. This framing may not fully capture the temporal dynamics of transcription or the regulatory complexity within TADs. Furthermore, the broad conclusion of an uncoupled relationship appears to challenge extensive prior evidence from perturbation studies showing that disrupting TAD boundaries can alter gene expression. The authors' own observation of reduced gene activity upon RAD21 degradation suggests that global TAD disruption can affect transcription. A more precise and limited conclusion, acknowledging that their data demonstrate a lack of detectable correlation between boundary distance and bursting activity in their system, would be more accurate and help reconcile these findings with the existing literature.

      (2) Technical methods and data presentation:

      (2.1) Accuracy and dimensionality of distance measurements: The manuscript does not clearly state whether distances are measured in 2D or 3D, nor does it sufficiently address precision limits. The stated Z-step size (1 µm) may be inadequate for accurately measuring sub-micron chromatin distances in 3D.

      (2.2) Probe design and systematic error: The genomic coverage size of the BAC probes used for DNA FISH is not explicitly stated. Large probe coverage could inherently blur the precise spatial location of adjacent DNA loci. The reported average distance (~300 nm) may be influenced by the physical size of the probes, as well as systematic expansion or distortion introduced by sample fixation and FISH processing. Although such technical limitations are currently unavoidable, the authors should clarify how these factors might affect their ability to detect subtle distance changes.

      (2.3) Data Visualization: The manuscript would benefit from including representative, zoomed-in regions of interest from the raw imaging data. This would allow readers to visually assess measured distance differences against background noise.

      (2.4) Potential impact of resolution limits: In Figure 5, the micro-C data reveal a clear difference in interaction patterns inside versus outside the VARS2 locus TAD, yet the imaging data show no corresponding distance difference. This strongly suggests that the current imaging system, limited by optical resolution, probe size, and localisation accuracy, may be unable to resolve finer-scale spatial reorganizations associated with specific chromatin conformations (e.g., enhancer-promoter loops). The authors should explicitly discuss that their conclusion of "no coupling observed" may be constrained by the resolution and sensitivity of their method and does not preclude the possibility of detecting such associations with higher-precision measurements or in live-cell dynamics.

      In summary, this study provides a valuable single-cell perspective. However, the authors should more cautiously define the scope of their findings in the manuscript and provide a more balanced discussion situating their work within the broader field.

    3. Reviewer #2 (Public review):

      Summary:

      Almansour et al. investigate whether the proximity of TAD boundaries is directly linked to gene activity. The authors use high-throughput imaging to simultaneously measure the gene activity and physical distances between boundary regions in an allele-specific manner. Using transcriptional inhibitors, expression induction, and acute depletion of CTCF and cohesin, they test whether proximity of boundaries affects, or is affected by, gene activity.

      Strengths:

      The combined use of DNA and RNA imaging enabled simultaneous measurement of boundary proximity and transcriptional status at individual alleles. This allows single-allele correlation between boundary proximity and gene activity at multiple loci across thousands of alleles.

      The use of both transcription inhibitors and transcription stimulation provides compelling and consistent evidence that boundary proximity can be disconnected from a gene's activity. The data convincingly support the conclusion that stable proximity between boundary regions is not required for ongoing transcription at the loci and timescales examined.

      This work strengthens the emerging view that genome organization at the level of domain boundaries does not impose a deterministic control over transcription.

      Weaknesses:

      In untreated cells, the distribution of distance measurements between boundary probes is exceptionally narrow. While depletion of RAD21 clearly demonstrates an ability to detect changes in this distribution, this tight baseline distribution may limit sensitivity to more subtle changes (like those one might expect from transcriptional influences). In addition, the correlation analysis is asymmetric, primarily stratifying by transcriptional status and then comparing boundary distances. Given the central claim that boundary architecture does not influence gene activity, the analysis should be done from the opposite perspective (stratifying by boundary distance).

      Strong disruption of boundary distances is only observed upon depletion of cohesin. Notably, this corresponds with the largest changes in gene activity. In contrast, depletion of CTCF actually had minimal impact on boundary distances and also had minimal impact on gene activity. This makes sense in light of previous work, where live cell imaging demonstrated that cohesin is more important for domain-structure, whereas CTCF is only important for blocking cohesin from continuing on, such that the fully formed loop occurs in a very small percentage of cells. Therefore, the fact that disruption of cohesin (more important for internal domain structure) affects gene activity while disruption of CTCF does not is exceptionally interesting but is lacking from the discussion.

      On a related note, this approach primarily tests the role of boundary interactions rather than domain organization as a whole, and it should be acknowledged that internal domain structures are not directly assessed.

      The comparison to work in other organisms (particularly the comparisons made to Drosophila) should be handled with care. The mechanisms underlying domain formation differ substantially across these systems, particularly regarding the differences in CTCF's role.

    1. eLife Assessment

      This study presents a high-quality cryo-EM structure of the human kinase PINK1 in complex with the HSP90-CDC37 chaperone complex, capturing a partially folded intermediate in which the C-lobe and C-terminal extension are structured while the N-lobe remains unfolded and engaged by the HSP90 clamp. The structural data are broadly consistent with a recently published structure of the same complex, providing useful insight into early steps of PINK1 maturation and highlighting residues linked to familial Parkinson's disease. However, the mechanistic conclusions remain incomplete because the manuscript does not experimentally validate key hypotheses raised by the structure, including the functional roles of the C-lobe interface, the HPNI motif, the C-terminal extension, or the proposed competition between HSP90 and TOM20.

    2. Reviewer #1 (Public review):

      Summary:

      The ubiquitin kinase PINK1 accumulates on damaged mitochondria to signal the initiation of mitophagy. While we know what PINK1 looks like when it is stabilised on damaged mitochondria, not much is known about how it gets there. In this study, Okatsu et al. solve a cryoEM structure of partially folded PINK1 in complex with its chaperones HSP90 and CDC37 to a resolution of 3.08 Å. This structure captures PINK1 in a state whereby the C-lobe of its kinase domain is folded, while the N-lobe remains unfolded and stabilised by an HSP90 dimer. According to the authors' model, their structure represents cytosolic PINK1 on its way to the mitochondria. This structure also demonstrates how PINK1 is folded in a step-wise mechanism and proposes a role for residues that are mutated in Parkinson's disease.

      Strengths:

      PINK1 is known to be a client of the HSP90 chaperone system. Here, Okatsu et al. present a solid structural dataset showing how PINK1 interacts with HSP90 and CDC37, and they describe key residues and motifs predicted to facilitate the interactions between PINK1 and the chaperones. Notably, two key residues within interacting regions on PINK1 are also mutated in Parkinson's disease. The structure by Okatsu et al. is in line with another recently published structure of the same complex (Tian et al. Nat Comms, 2025), which appears very similar, further supporting the findings. Together, these two studies represent the first observations of cytosolic PINK1 in a semi-folded state, which provides a novel insight into PINK1 at an earlier stage within the signalling cascade.

      Weaknesses:

      This paper is not the first to describe the structure of the PINK1-HPS90-CDC37 complex. A study by Tian et al. was published in early December 2025 in Nature Communications, reporting a 2.84 Å structure of PINK1-HSP90-CDC37, as well as a structure of PINK1 with HSP90 and another HSP90 co-chaperone, FKBP51. It would be important to acknowledge this comparable study and to discuss how the structure in this study compares with the Tian et al. structures and whether it reveals any additional information.

      Although they make claims about the functional relevance of PINK1-interacting residues, the study by Okatsu et al. does not include any biochemical or functional validation of the structure. To support their claims, the authors should test the PINK1-HSP90-CDC37 interaction using their recombinant proteins for mutants of the conserved hydrophobic PINK1 residues in the PINK1 c-lobe, H352, L353, H360, I382, D384, as well as the PINK1 HPNI motif, especially the PD mutation H271Q. The PINK1 PD mutation L347P, which interacts with the CDC37 HPNI moti,f is also worth testing.

      A major question that arises from this work is whether the PINK1-HSP90-CDC37 complex is newly translated PINK1 on its way to mitochondria (as suggested by the authors) or PINK1 that has already entered mitochondria, been cleaved and then retrotranslocated. This latter scenario is the favoured model proposed by Tian et al. (Nat Comms) based on their biochemical experiments. The discrepancies between the two models should at least be discussed, and the authors should also attempt to demonstrate experimentally whether their model is correct. This question is important to address because it would allow this structural information to be placed in the greater context of PINK1 signalling.

      It is also unclear what the consequences are of disrupted PINK1-HSP90-CDC37 interactions on the PINK1 signalling process more broadly - does PINK1 accumulate in the cytosol? Is there less of it? Can it still be degraded via the N-end rule? What happens during mitophagy? Perhaps some of these questions can be answered with cell-based studies using a selection of the PINK1 mutants mentioned above that disrupt the PINK1-HSP90-CDC37 complex formation.

    3. Reviewer #2 (Public review):

      Summary:

      Okatsu et al report the cryoEM structure of the PINK1-HSP90-CDC37 complex at 3.08A. To do so, they mutated the PARL cleavage site (F104M) and removed the N-terminal 103 a.a. The construct was co-expressed with HSP90beta and CDC37 in insect cells, as performed previously for other kinase-HSP90-CDC37 complexes (e.g. Raf1). Molybdate was added to prevent cycling between open and closed HSP90 conformations. The initial characterization by single particle cryoEM reveals two HSP90 conformations: closed with CDC37 dissociated, and open with the CTD of HSP90 separated. Thus, the authors crosslinked the complex, which yielded a more homogenous closed structure with clearly visible density for HSP90, CDC37, and PINK1. The structure shows an immature or partially folded kinase domain conformation for PINK1, with the C-lobe bound to HSP90 and the N-lobe unfolded. The C-lobe binds to HSP90 via the HPNI motif in CDC37, which mimics the HPNI motif found in the N-lobe of kinases, and which is conserved across kinases. The main novelty here is the interaction between the C-terminal extension (CTE) of PINK1, which must adopt another conformation than in the folded state, which would otherwise clash with HSP90. The interaction with the CTE is notably mediated by the flexible charged linker (FCL) of HSP90, which is partially disordered. In this conformation, HSP90 would clash with TOM20 binding.

      Strengths:

      Overall, this is well-executed structural biology work, which brings insight into the elements required to fold PINK1. The protein engineering used in this study is of great value and will help others in the field explore the function of PINK1 folding. Understanding the mode of activation of PINK1 is important, and this work brings forward hypotheses that are worthy of testing.

      Weaknesses:

      In the absence of functional assays, the study does not bring much novelty or biological insights. Furthermore, there are already several structures of HSP90-CDC37 bound to partially folded kinases, and a simple superposition of these structures on the model of HsPINK1 allows similar conclusions to be drawn, i.e. that it would bind a folded C-lobe and unfolded N-lobe. Furthermore, a very similar structure of PINK1 bound to HSP90-CDC37 (and FKBP5) was published in Nature Communications in December 2025 by another group. The main novelty from this work (and the paper published in December) is that the CTE adopts a different conformation compared to the mature form, but the implications of this are not explored. Furthermore, the authors propose that HSP90 would compete with TOM20, but what dictates the outcome of this competition? More importantly, how do these results help understand how PINK1 become active? Again, this is not explored.

    1. eLife Assessment

      This valuable study demonstrates molecular changes associated with age related impairment in oligodendrocyte differentiation and ability to myelinate. The identification of particular genes that are associated with this decline will provide potential future targets for therapeutic interventions. The reviewers felt that the quality of the evidence was solid while identifying some minor weaknesses that if addressed would enhance the rigor of the study.

    2. Reviewer #1 (Public review):

      Summary:

      This manuscript by Ghosh and colleagues investigates the transcriptional changes within the oligodendrocyte lineage that contribute to age-related declines in oligodendrocyte differentiation and myelination. Combining bulk RNA-Seq on acutely purified oligodendrocyte lineage cells with bioinformatic approaches, the authors identify groups of genes that show different patterns of dynamic regulation during differentiation (which they term "switch" genes, or "switches"). A subset of these switch genes is differentially regulated with age. The authors identify two transcription factors, Bcl11a and Foxm1, that are downregulated during differentiation, have predicted binding site enrichment at other switch genes, and are downregulated in aged OPCs. Functionally testing Bcl11a, the authors show that Bcl11a knockdown inhibits the differentiation of young OPCs in culture, whereas overexpression promotes the differentiation of aged OPCs. Viral expression of Bcl11a in Sox10-expressing cells accelerates the formation of Plp1+ oligodendrocytes in aged rodents following lysolecithin induced demyelination.

      Strengths:

      The work is clearly presented and addresses an important biological problem. The bioinformatic approaches used in the manuscript are powerful, and the identification of Bcl11a as a modulator of oligodendrocyte differentiation is a novel finding. The combined in vitro and in vivo approaches to assess the function of Bcl11a in oligodendrocyte differentiation are a substantial strength of the work.

      Weaknesses:

      Although the PCA plots show distinct and reproducible global gene expression differences between the different isolated cell populations, the authors do not present a figure showing expression levels of typical stage-specific markers (e.g., Pdgfra, Pcdh15, C1ql1 for OPCs, Bcas1, Enpp6, Gpr17 for preOLs, Mobp, Mog, etc. for OLs) or confirm the absence of markers of other lineages (astrocytes, neurons, microglia, etc.). This makes it difficult to evaluate the success of their cell isolation strategy at different ages without reanalyzing the raw data. In addition, other publicly available datasets (e.g., the Barres lab bulk RNA-Seq datasets from PMID 25186741 or the Castelo-Branco lab single cell datasets from PMID 27284195) do not show downregulation of Bcl11a during OL differentiation as is described here - this apparent discrepancy is not discussed.

    3. Reviewer #2 (Public review):

      Aging poses a significant challenge to the regenerative capacity of oligodendrocyte precursor cells (OPCs) to differentiate and myelinate neuronal axons. Myelin abnormalities accumulate with age, and it is likely that the ability of OPCs to differentiate into myelinating oligodendrocytes becomes progressively impaired during aging, leading to inefficient turnover of damaged myelin and oligodendrocytes, as well as reduced adaptive myelination. Understanding the molecular mechanisms underlying the compromised capacity of aged OPCs is therefore critical for addressing age-related white matter decline.

      This study aims to decipher the intrinsic molecular changes that occur in aged OPCs. By profiling differentially expressed transcription factors (TFs) between young and aged OPCs, and by employing a novel bioinformatic tool to identify key TFs that undergo dynamic changes across distinct stages of OPC differentiation, the authors identify Bcl11a as a potential regulator. Bcl11a is highly expressed in young OPCs but markedly reduced in aged cells. Functional experiments further demonstrate that while Bcl11a does not affect OPC proliferation, it significantly promotes the differentiation of aged OPCs. Importantly, this effect is also observed in vivo following demyelinating injury in aged mice.

      While the study provides compelling evidence that BCL11A represents a limiting factor for OPC differentiation during ageing, the downstream targets and molecular mechanisms through which BCL11A exerts its effects are not directly addressed. As such, the work should be interpreted primarily as identifying a key regulatory node rather than a fully defined molecular pathway.

      Overall, this study offers valuable insights into the age-related loss of regenerative capacity in the central nervous system and introduces a computational framework that may be broadly useful for investigating dynamic gene regulation in other biological contexts.

      Major Points:

      (1) MACS mouse anti-A2B5 microbeads are not OPC-specific and may also label astrocyte precursor cells or immature astrocytes. How do the authors justify this caveat? Could some of the claimed "OPC-specific" switch genes in fact be enriched in astrocyte lineage cells?

      (2) Overall, Figures 1 and 2 are not very informative in terms of biological insight. The authors should provide more detail in the main figures regarding the enriched gene sets associated with each of the Type 1-4 switch categories. For example, summarizing the top Gene Ontology terms for each switch type would greatly enhance interpretability.

      (3) A similar issue applies to Figure 3. The authors should explicitly specify the transcription factors in the main figure, particularly the 27 TFs identified through the ENCODE/ReMap2 analysis.

      (4) Have the authors validated Bcl11a expression across different CNS cell types and between young and aged conditions using independent methods such as qPCR, immunofluorescence, or western blotting?

      (5) Regarding OPC aging, an open question is whether the reduced differentiation capacity of aged OPCs is an intrinsic property of the cells themselves or whether it results from prolonged exposure to an aging environment that induces non-cell-autonomous epigenetic or genetic changes, thereby rendering OPCs less efficient at differentiating. It would be helpful if the authors could expand on this point in the Discussion, with reference to relevant previous studies and experimental evidence.

      (6) Do the authors observe a change in the number or density of OPCs between young and aged mice?

      (7) The in vivo characterization of Bcl11a overexpression using the AAV-based approach appears incomplete. Do aged mice overexpressing Bcl11a in Sox10⁺ cells exhibit reduced age-related myelin degeneration under baseline conditions? In the LPC model, do the authors observe differences in lesion size and/or remyelination efficiency?

      (8) Are the authors presenting gSWITCH for the first time in this manuscript? Given that the gSWITCH framework is novel and central to the study, its conceptual contribution could be emphasized more strongly. A brief comparison with existing trajectory- or pattern-based methods-ideally in the main text around Figure 1-would help readers better appreciate its novelty.

      (9) The evolutionary analysis also appears somewhat disconnected from the rest of the study. Could the authors leverage available public datasets to test whether a similar Bcl11a expression trajectory is observed in human oligodendrocyte lineage cells?

    1. eLife Assessment

      This useful study develops an individual-based model to investigate the evolution of division of labor in vertebrates, comparing the contributions of group augmentation and kin selection. The findings are solid in showing that, within the specific structure of the model and the parameter space explored, group augmentation can robustly favor the evolution of differentiated helper roles, particularly when age-dependent task switching and dominance dynamics are allowed to evolve. However, the evidence only partially supports the authors' broader claim that group augmentation is the primary driver of vertebrate division of labor. Several modelling assumptions, including the limited scope for synergistic task benefits, the restriction of helper effects to group-size-mediated benefits, and the relatively narrow exploration of cost and benefit parameters, constrain the potential for kin selection to generate division of labor and limit the generality of the conclusions.

    2. Reviewer #2 (Public review):

      Summary:

      This paper formulates an individual-based model to understand the evolution of division of labor in vertebrates. The model considers a population subdivided in groups, each group has a single asexually-reproducing breeder, other group members (subordinates) can perform two types of tasks called "work" or "defense", individuals have different ages, individuals can disperse between groups, each individual has a dominance rank that increases with age, and upon death of the breeder a new breeder is chosen among group members depending on their dominance. "Workers" pay a reproduction cost by having their dominance decreased, and "defenders" pay a survival cost. Every group member receives a survival benefit with increasing group size. There are 6 genetic traits, each controlled by a single locus, that control propensities to help and disperse, and how task choice and dispersal relate to dominance. To study the effect of group augmentation without kin selection, the authors cross-foster individuals to eliminate relatedness. The paper allows for the evolution of the 6 genetic traits under some different parameter values to study the conditions under which division of labour evolves, defined as the occurrence of different subordinates performing "work" and "defense" tasks. The authors envision the model as one of vertebrate division of labor.

      The main conclusion of the paper is that group augmentation is the primary factor causing the evolution of vertebrate division of labor, rather than kin selection. This conclusion is drawn because, for the parameter values considered, when the benefit of group augmentation is set to zero, no division of labor evolves and all subordinates perform "work" tasks but no "defense" tasks.

      Strengths:

      The model incorporates various biologically realistic details, including the possibility to evolve age polytheism where individuals switch from "work" to "defence" tasks as they age or vice versa, as well as the possibility of comparing the action of group augmentation alone with that of kin selection alone.

      Weaknesses from the previous round of review::

      The model and its analysis are limited, which in my view makes the results insufficient to reach the main conclusion that group augmentation and not kin selection is the primary cause of the evolution of vertebrate division of labour. There are several reasons.

      First, although the main claim that group augmentation drives the evolution of division of labour in vertebrates, the model is rather conceptual in that it doesn't use quantitative empirical data that applies to all/most vertebrates and vertebrates only. So, I think the approach has a conceptual reach rather than being able to achieve such conclusion about a real taxon.

      Second, I think that the model strongly restricts the possibility that kin selection is relevant. The two tasks considered essentially differ only by whether they are costly for reproduction or survival. "Work" tasks are those costly for reproduction and "defense" tasks are those costly for survival. The two tasks provide the same benefits for reproduction (eqs. 4, 5) and survival (through group augmentation, eq. 3.1). So, whether one, the other, or both helper types evolve presumably only depends on which task is less costly, not really on which benefits it provides. As the two tasks give the same benefits, there is no possibility that the two tasks act synergistically, where performing one task increases a benefit (e.g., increasing someone's survival) that is going to be compounded by someone else performing the other task (e.g., increasing that someone's reproduction). So, there is very little scope for kin selection to cause the evolution of labour in this model. Note synergy between tasks is not something unusual in division of labour models, but is in fact a basic element in them, so excluding it from the start in the model and then making general claims about division of labour is unwarranted. In their reply, the authors point out that they only consider fertility benefits as this, according to them, is what happens in cooperative breeders with alloparental care; however, alloparental care entails that workers can increase other's survival *without group augmentation*, such as via workers feeding young or defenders reducing predator-caused mortality, as a mentioned in my previous review but these potentially kin-selected benefits are not allowed here.

      Third, the parameter space is understandably little explored. This is necessarily an issue when trying to make general claims from an individual-based model where only a very narrow parameter region of a necessarily particular model can be feasibly explored. As in this model the two tasks ultimately only differ by their costs, the parameter values specifying their costs should be varied to determine their effects. In the main results, the model sets a very low survival cost for work (yh=0.1) and a very high survival cost for defense (xh=3), the latter of which can be compensated by the benefit of group augmentation (xn=3). Some limited variation of xh and xn is explored, always for very high values, effectively making defense unevolvable except if there is group augmentation. In this revision, additional runs have been included varying yh and keeping xh and xn constant (Fig. S6), so without addressing my comment as xn remains very high. Consequently, the main conclusion that "division of labor" needs group augmentation seems essentially enforced by the limited parameter exploration, in addition to the second reason above.

      Fourth, my view is that what is called "division of labor" here is an overinterpretation. When the two helper types evolve, what exists in the model is some individuals that do reproduction-costly tasks (so-called "work") and survival-costly tasks (so-called "defense"). However, there are really no two tasks that are being completed, in the sense that completing both tasks (e.g., work and defense) is not necessary to achieve a goal (e.g., reproduction). In this model there is only one task (reproduction, equation 4,5) to which both helper types contribute equally and so one task doesn't need to be completed if completing the other task compensates for it; instead, it seems more fitting to say that there are two types of helpers, one that pays a fertility cost and another one a survival cost, for doing the same task. So, this model does not actually consider division of labor but the evolution of different helper types where both helper types are just as good at doing the single task but perhaps do it differently and so pay different types of costs. In this revision, the authors introduced a modified model where "work" and "defense" must be performed to a similar extent. Although I appreciate their effort, this model modification is rather unnatural and forces the evolution of different helper types if any help is to evolve.

      I should end by saying that these comments don't aim to discourage the authors, who have worked hard to put together a worthwhile model and have patiently attended to my reviews. My hope is that these comments can be helpful to build upon what has been done to address the question posed.

      [Editors' note: the authors have provided responses to the each of these points.]

    3. Author response:

      The following is the authors’ response to the previous reviews

      Public Reviews:

      Reviewer #2 (Public review):

      Summary:

      This paper formulates an individual-based model to understand the evolution of division of labor in vertebrates. The model considers a population subdivided in groups, each group has a single asexually-reproducing breeder, other group members (subordinates) can perform two types of tasks called "work" or "defense", individuals have different ages, individuals can disperse between groups, each individual has a dominance rank that increases with age, and upon death of the breeder a new breeder is chosen among group members depending on their dominance. "Workers" pay a reproduction cost by having their dominance decreased, and "defenders" pay a survival cost. Every group member receives a survival benefit with increasing group size. There are 6 genetic traits, each controlled by a single locus, that control propensities to help and disperse, and how task choice and dispersal relate to dominance. To study the effect of group augmentation without kin selection, the authors cross-foster individuals to eliminate relatedness. The paper allows for the evolution of the 6 genetic traits under some different parameter values to study the conditions under which division of labor evolves, defined as the occurrence of different subordinates performing "work" and "defense" tasks. The authors envision the model as one of vertebrate division of labor.

      The main conclusion of the paper is that group augmentation is the primary factor causing the evolution of vertebrate division of labor, rather than kin selection. This conclusion is drawn because, for the parameter values considered, when the benefit of group augmentation is set to zero, no division of labor evolves and all subordinates perform "work" tasks but no "defense" tasks.

      Strengths:

      The model incorporates various biologically realistic details, including the possibility to evolve age polytheism where individuals switch from "work" to "defense" tasks as they age or vice versa, as well as the possibility of comparing the action of group augmentation alone with that of kin selection alone.

      Weaknesses:

      The model and its analysis are limited, which in my view makes the results insufficient to reach the main conclusion that group augmentation and not kin selection is the primary cause of the evolution of vertebrate division of labor. There are several reasons.

      (1) First, although the main claim that group augmentation drives the evolution of division of labor in vertebrates, the model is rather conceptual in that it doesn't use quantitative empirical data that applies to all/most vertebrates and vertebrates only. So, I think the approach has a conceptual reach rather than being able to achieve such a conclusion about a real taxon.

      We appreciate the reviewer’s point that our model does not incorporate quantitative empirical data across vertebrate taxa. This is indeed a limitation and reflects the current lack of fine-scale datasets on task division, the influence of life-history traits, and the fitness consequences of different cooperative activities in vertebrates. One of our aims, however, is precisely to stimulate such empirical work by highlighting the value of examining division of labor in species inhabiting harsh environments, considering age/size/dominance structure when evaluating variation in cooperative activities, and incorporating defense behaviors more consistently into analyses of helping, especially since defenders are often overlooked relative to the classic helpers-at-the-nest that provision offspring. The model therefore remains directly relevant to vertebrate systems because it departs from insect-inspired approaches that focus on fitness outcomes based solely in maximizing colony productivity. Instead, it incorporates direct fitness benefits to group members, an essential feature of vertebrate cooperative breeding and of other systems with fertile “workers,” as we clarified in the discussion.

      (2) Second, I think that the model strongly restricts the possibility that kin selection is relevant. The two tasks considered essentially differ only by whether they are costly for reproduction or survival. "Work" tasks are those costly for reproduction and "defense" tasks are those costly for survival. The two tasks provide the same benefits for reproduction (eqs. 4, 5) and survival (through group augmentation, eq. 3.1). So, whether one, the other, or both helper types evolve presumably only depends on which task is less costly, not really on which benefits it provides. As the two tasks give the same benefits, there is no possibility that the two tasks act synergistically, where performing one task increases a benefit (e.g., increasing someone's survival) that is going to be compounded by someone else performing the other task (e.g., increasing that someone's reproduction). So, there is very little scope for kin selection to cause the evolution of labor in this model. Note synergy between tasks is not something unusual in division of labor models, but is in fact a basic element in them, so excluding it from the start in the model and then making general claims about division of labor is unwarranted. In their reply, the authors point out that they only consider fertility benefits as this, according to them, is what happens in cooperative breeders with alloparental care; however, alloparental care entails that workers can increase other's survival *without group augmentation*, such as via workers feeding young or defenders reducing predator-caused mortality, as a mentioned in my previous review but these potentially kin-selected benefits are not allowed here.

      We understand the reviewer’s concern that our model restricts the scope for kin-selected benefits by not including task-specific synergy effects—specifically, help that directly increases the survival of group members (e.g., load-lightening via feeding young, or predator defense that reduces mortality of breeders or offspring independently of group augmentation). We agree that such effects can occur in some cooperative breeders, and that they can, in principle, generate indirect fitness benefits. However, even when helpers increase the survival of breeders or reduce parental investment per offspring, these effects generally translate into higher breeder productivity—either via increased fecundity, increased survival to the next breeding attempt, or increased investment in subsequent broods. Thus, although we treat benefits in terms of enhanced breeder productivity, this formulation implicitly captures a range of help-related effects that ultimately improve the reproductive output of the breeders, including those mediated through increased survival. For this reason, we believe that the model remains relevant for vertebrate systems despite not representing each pathway separately.

      (3) Third, the parameter space is understandably little explored. This is necessarily an issue when trying to make general claims from an individual-based model where only a very narrow parameter region of a necessarily particular model can be feasibly explored. As in this model the two tasks ultimately only differ by their costs, the parameter values specifying their costs should be varied to determine their effects. In the main results, the model sets a very low survival cost for work (yh=0.1) and a very high survival cost for defense (xh=3), the latter of which can be compensated by the benefit of group augmentation (xn=3). Some limited variation of xh and xn is explored, always for very high values, effectively making defense unevolvable except if there is group augmentation. In this revision, additional runs have been included varying yh and keeping xh and xn constant (Fig. S6), so without addressing my comment as xn remains very high. Consequently, the main conclusion that "division of labor" needs group augmentation seems essentially enforced by the limited parameter exploration, in addition to the second reason above.

      As we have explained in previous revisions, the costs associated with work and defense are not directly comparable because they affect different fitness components: work costs reduce dominance, whereas defense costs reduce survival. Whether a particular cost is “high” or “low” can only be evaluated by examining the evolved reaction norms and identifying the ranges over which these norms change. For this reason, we focused on parameter ranges that actually generate shifts in reaction norms rather than presenting large regions of parameter space where nothing changes.

      We also reiterate that we did in fact explore broader parameter ranges than those shown in the main text. Additional analyses, including those specifically designed to identify conditions under which division of labor evolves under kin selection alone, are provided in the Supplementary Material. Specifically, Figure S1 addresses the point raised by the “need” of group augmentation benefits for defense to evolve, by increasing the baseline survival x<sub>0</sub>.

      We now include one additional figure in the Supplementary Material with a lower value for the benefit of group size (x<sub>n</sub> = 1 instead of x<sub>n</sub> = 3), and we extended the range of x<sub>h</sub> to include lower values (x<sub>h</sub> = 1). As we can see in Figure S7 and Table S8, group augmentation benefits are still the primary reason for individuals to group (see dispersal values). For low benefits of group augmentation, defense evolves in harsh environments in the absence of kin selection, and in benign environments when both direct and indirect fitness benefits take place. We have also now expanded the results section to include these last results. Note that we also checked even lower values for x<sub>h</sub> under the only kin selection implementation, with results being qualitatively similar, but chose not to include them in the manuscript since it is already a very long Supplementary Material. Here are the averages for two examples with x<sub>h</sub> = 0.1 and when we promote division of labor:

      Author response table 1.

      In short, the conclusion that division of labor requires group augmentation is not an artifact of limited parameter exploration. It arises because kin selection alone favors division of labor only under highly restrictive parameter combinations, whereas including direct fitness benefits substantially expands the conditions under which division of labor evolves. This pattern is consistent across the full set of parameter combinations we examined.

      (4) Fourth, my view is that what is called "division of labor" here is an overinterpretation. When the two helper types evolve, what exists in the model is some individuals that do reproduction-costly tasks (so-called "work") and survival-costly tasks (so-called "defense"). However, there are really no two tasks that are being completed, in the sense that completing both tasks (e.g., work and defense) is not necessary to achieve a goal (e.g., reproduction). In this model there is only one task (reproduction, equation 4,5) to which both helper types contribute equally and so one task doesn't need to be completed if completing the other task compensates for it; instead, it seems more fitting to say that there are two types of helpers, one that pays a fertility cost and another one a survival cost, for doing the same task. So, this model does not actually consider division of labor but the evolution of different helper types where both helper types are just as good at doing the single task but perhaps do it differently and so pay different types of costs. In this revision, the authors introduced a modified model where "work" and "defense" must be performed to a similar extent. Although I appreciate their effort, this model modification is rather unnatural and forces the evolution of different helper types if any help is to evolve.

      In previous models of division of labor in eusocial insects, the implicit benefit is also colony-level productivity (see Beshers & Fewell, 2001, for a review of division of labor in insects). Even in humans, division of labor functions as a means to increase efficiency toward achieving a shared goal. Our model adopts this same interpretation, as outlined in the Introduction, but extends it by considering that different tasks may impose different fitness costs, an aspect that has been largely overlooked in the existing literature. It is precisely because fitness outcomes are not fully shared among group members in vertebrates that distinguishing these cost structures matters. Unlike eusocial insects with sterile workers, vertebrate helpers can obtain direct fitness benefits, and the model explicitly accounts for these direct benefits—something absent from most insect-inspired approaches even when direct fitness benefits can also arise in some of those systems. Thus, our framework is not simply evolving “two types of helpers doing the same task,” but instead evolving specialization in different cooperative roles that carry different fitness consequences. It is therefore suitable for our model to treat contributions to breeder productivity as a common currency, while allowing individuals to specialize in different cost-distinct forms of help.

      Finally, regarding synergy: with the extension introduced in the previous revision, we now incorporate the requirement that multiple forms of help must be performed for the group to achieve maximal reproductive output. This directly addressed the reviewer’s concern about synergistic dependencies between tasks and aligns our framework with the kinds of complementarity highlighted in other models of division of labor.

      In summary, the structure of the model is consistent with both the theoretical literature on division of labor and the biological realities of vertebrate cooperative systems. We believe it is important for future models to explicitly consider the different fitness benefits and costs associated with distinct cooperative behaviors, and hope that our framework encourages more targeted empirical research on division of labor in vertebrates (e.g. inclusion of data on defense, life-history traits and environmental challenges) to better inform future modelling efforts.

      I should end by saying that these comments don't aim to discourage the authors, who have worked hard to put together a worthwhile model and have patiently attended to my reviews. My hope is that these comments can be helpful to build upon what has been done to address the question posed.

      We appreciate the reviewer’s thoughtful and constructive comments, as well as the time invested in evaluating our work. These insights have greatly helped us improve the clarity and overall quality of the manuscript. We hope that the revisions and additional clarifications we have provided adequately address all remaining concerns.

    1. eLife Assessment

      This manuscript provides valuable novel insights into the role of interpersonal guilt in social decision-making by showing that responsibility for a partner's bad lottery outcomes influences happiness. Through the integration of neuroimaging and computational modelling methods, and by combining findings from two studies, the authors provide solid support for their claims. The findings will be of interest to researchers in the field of social neuroscience and decision making.

    2. Reviewer #1 (Public review):

      Summary:

      The authors aimed to characterize neurocomputational signals underlying interpersonal guilt and responsibility. Across two studies, one behavioral and one fMRI, participants made risky economic decisions for themselves or for themselves and a partner; they also experienced a condition in which the partners made decisions for themselves and the participant. The authors also assessed momentary happiness intermittently between choices in the task. Briefly, the results demonstrated that participants' self-reported happiness decreased after disadvantageous outcomes for themselves and when both they and their partner were affected; and this effect was exacerbated when participants were responsible for their partner's low outcome, rather than the opposite, reflecting experienced guilt. Consistent with previous work, BOLD signals in the insula correlated with experienced guilt and insula-right IFG connectivity was enhanced when participants made risky choices for themselves and safe choices for themselves and a partner.

      Strengths:

      This study implements an interesting approach to investigating guilt and responsibility; the paradigm in particular is well-suited to approach this question, offering participants the chance to make risky vs. safe choices that affect both themselves and others. I appreciate the assessment of happiness as a metric for assessing guilt across the different task/outcome conditions, as well as the implementation of both computational models and fMRI.

      Weaknesses:

      In spite of the overall strengths of the study, I think there are a few areas in which the paper fell a bit short and could be improved.

      Comment on the revised submission:

      I appreciate the authors' attention to all of my comments and questions regarding the initial version of the paper. However, I still do not believe that the point about the small volume correction in the insula has been adequately addressed. The authors claim that because the SVC was done using an anatomically defined ROI, that it is valid and not double dipping. I understand where the authors are coming from. However, there are a few issues here. First, any use of ROIs is best done via pre-registration (Gentili et al., 2021, European Journal of Neuroscience). Second, the whole set of analyses in this section leading up to the SVC seems somewhat circular. The first step was a whole brain contrast of lottery vs. safe outcomes, which revealed activation in many areas including the insula. Then, it appears that the parameter estimates from the insula were extracted and submitted offline to linear mixed models probing for effects of outcome magnitude, social condition and time, which revealed that the insula activation demonstrated the 'sought after' effect. Next, the manuscript states that the authors attempted to confirm these results with a univariate analysis for the so-called guilt effect within regions showing a stronger response to outcomes of risky relative to safe outcomes, which again showed activation in the insula (not surprisingly), and then a small volume correction was applied to these insula voxels. While an anatomical ROI from a different study was used for the correction, the issue is that multiple analyses already revealed that the insula was involved in the effect of interest. It is unclear why this is even necessary given that the LMM analysis demonstrated the expected result.

    3. Reviewer #2 (Public review):

      Summary

      This manuscript focuses on the role of social responsibility and guilt in social decision making by integrating neuroimaging and computational modeling methods. Across two studies, participants completed a lottery task in which they made decisions for themselves or for a social partner. By measuring momentary happiness throughout the task, the authors show that being responsible for a partner's bad lottery outcome leads to decreased happiness compared to trials in which the participant was not responsible for their partner's bad outcome. At the neural level, this guilt effect was reflected in increased neural activity in the anterior insula, and altered functional connectivity between the insula and the inferior frontal gyrus. Using computational modeling, the authors show that trial by trial fluctuations in happiness were successfully captured by a model including participant and partner rewards and prediction errors (a 'responsibility' model), and model-based neuroimaging analyses suggested that prediction errors for the partner were tracked by the superior temporal sulcus. Taken together, these findings suggest that responsibility and interpersonal guilt influence social decision making.

      Strengths

      This manuscript investigates the concept of guilt in social decision making through both statistical and computational modeling. It integrates behavioral and neural data, providing a more comprehensive understanding of the psychological mechanisms. For the behavioral results, data from two different studies is included, and although minor differences are found between the two studies, the main findings remain consistent. The authors share all their code and materials, leading to transparency and reproducibility of their methods.

      The manuscript is well-grounded in prior work. The task design is inspired by a large body of previous work on social decision making, and includes the necessary conditions to support their claims (i.e., Solo, Social, and Partner conditions). The computational models used in this study are inspired by previous work, and build on well-established economic theories of decision making. The research question and hypotheses clearly extend previous findings, and the more traditional univariate results align with prior work.

      The authors conducted extensive analyses, as supported by the inclusion of different linear models and computational models described in the supplemental materials. Psychological concepts like risk preferences are defined and tested in different ways, and different types of analyses (e.g., univariate and multivariate neuroimaging analyses) are used to try to answer the research questions. The inclusion and comparison of different computational models provides compelling support for the claim that partner prediction errors indeed influence task behavior, as illustrated by the multiple model comparison metrics and the good model recovery.

      The authors did a good job acknowledging other factors that could differ between the conditions, including the role of other emotions (like empathy) or agency in the decision making process. These additional analyses and nuances strengthen the manuscript and the interpretability of the findings.

      Weaknesses

      As the authors already note, they did not directly ask participants to report their feelings of guilt. The authors clearly describe this limitation, and also note that in addition to guilt, other emotions like empathy could also be at play in interpersonal decisions. Despite this limitation, this study provides insights into the neural and behavioral mechanisms of responsibility and guilt in social decision making, and how they influence behavior.

    4. Author response:

      The following is the authors’ response to the original reviews.

      Public Reviews:

      Reviewer #1 (Public review):

      Summary

      The authors aimed to characterize neurocomputational signals underlying interpersonal guilt and responsibility. Across two studies, one behavioral and one fMRI, participants made risky economic decisions for themselves or for themselves and a partner; they also experienced a condition in which the partners made decisions for themselves and the participant. The authors also assessed momentary happiness intermittently between choices in the task. Briefly, results demonstrated that participants' self-reported happiness decreased after disadvantageous outcomes for themselves and when both they and their partner were affected; this effect was exacerbated when participants were responsible for their partner's low outcome, rather than the opposite, reflecting experienced guilt. Consistent with previous work, BOLD signals in the insula correlated with experienced guilt, and insula-right IFG connectivity was enhanced when participants made risky choices for themselves and safe choices for themselves and a partner.

      Strengths:

      This study implements an interesting approach to investigating guilt and responsibility; the paradigm in particular is well-suited to approach this question, offering participants the chance to make risky v. safe choices that affect both themselves and others. I appreciate the assessment of happiness as a metric for assessing guilt across the different task/outcome conditions, as well as the implementation of both computational models and fMRI.

      We thank Reviewer 1 for their positive assessment of our manuscript.

      Weaknesses:

      In spite of the overall strengths of the study, I think there are a few areas in which the paper fell a bit short and could be improved.

      We thank Reviewer 1 for their comments, which we have used to improve our manuscript. We hope that these changes address the issues raised by the Reviewer.

      (1) While the framing and goal of this study was to investigate guilt and felt responsibility, the task implemented - a risky choice task with social conditions - has been conducted in similar ways in past research that were not addressed here. The novelty of this study would appear to be the additional happiness assessments, but it would be helpful to consider the changes noted in risk-taking behavior in the context of additional studies that have investigated changes in risky economic choice in social contexts (e.g., Arioli et al., 2023 Cerebral Cortex; Fareri et al., 2022 Scientific Reports).

      We certainly agree that several previously published studies have relied on risky choice tasks with social conditions. In this revised version, we now mention these two studies in the substantially revised Introduction.

      (2) The authors note they assessed changes in risk preferences between social and solo conditions in two ways - by calculating a 'risk premium' and then by estimating rho from an expected utility model. I am curious why the authors took both approaches (this did not seem clearly justified, though I apologize if I missed it). Relatedly, in the expected utility approach, the authors report that since 'the number of these types of trials varied across participants', they 'only obtained reliable estimates for [gain and loss] trials in some participants' - in study 1, 22 participants had unreliable estimates and in study 2, 28 participants had unreliable estimates. Because of this, and because the task itself only had 20 gains, 20 losses, and 20 mixed gambles per condition, I wonder if the authors can comment on how interpretable these findings are in the Discussion. Other work investigating loss aversion has implemented larger numbers of trials to mitigate the potential for unreliable estimates (e.g., Sokol-Hessner et al., 2009).

      We agree that we have not clearly justified why we have taken two approaches to assess risk preferences. In short, while the expected utility approach is a more comprehensive method to model a participant’s choices, we had not sufficiently considered the need for the large number of trials required to fit such models when designing our experiment. Calculating the risk premium was the less comprehensive, simpler alternative that we could calculate for all participants. We have now mentioned this fact in the Results section. As the only difference in risk aversion across conditions was found in Study 1 using the expected utility method, which could only be successfully applied in a minority of participants, we believe that this difference should not be taken as a strong finding. We have now mentioned this fact in the revised Discussion.

      (3) One thing seemingly not addressed in the Discussion is the fact that the behavioral effect did not replicate significantly in study 2.

      We agree that we had not sufficiently discussed the fact that there were (slight but significant) differences in risk preferences between the Solo and Social conditions in Study 1 but not in Study 2. We now do so in the revised Discussion, and write the following:

      “Participants made slightly more risk-seeking choices when deciding for themselves than for both themselves and the partner in Study 1, but this difference disappeared in Study 2. The ρ parameter on which this finding in Study 1 is based could only be estimated in a minority of participants due to a relatively low number of trials, which suggests that this finding may not be very reliable. The simpler and more robust method (evaluation of a risk premium) showed no difference in risk aversion across conditions in either study. Overall, we believe that we do not have strong evidence of differences in risk preferences across conditions.”

      (4) Regarding the computational models, the authors suggest that the Reponsibility and Responsibility Redux models provided the best fit, but they are claiming this based on separate metrics (e.g., in study 1, the redux model had the lowest AIC, but the responsibility only model had the highest R^2; additionally, the basic model had the lowest BIC). I am wondering if the authors considered conducting a direct model comparison to statistically compare model fits.

      We agree that we should run formal, direct model comparison tests. We now ran likelihood-ratio tests which showed that the Responsibility model was the best. We now report this in the Results section, just below Table 1:

      “A likelihood ratio test (Equation 9) revealed that the Responsibility model fitted better than all the other models, including the Responsibility Redux model (Study 1: all LR ≥ 47.36, p < 0.0001; Study 2: all LR ≥ 77.83, p < 0.0001).”

      (5) In the reporting of imaging results, the authors report in a univariate analysis that a small cluster in the left anterior insula showed a stronger response to low outcomes for the partner as a result of participant choice rather than from partner choice. It then seems as though the authors performed small volume correction on this cluster to see whether it survived. If that is accurate, then I would suggest that this result be removed because it is not recommended to perform SVC where the volume is defined based on a result from the same whole-brain analysis (i.e., it should be done a priori).

      As indicated in the manuscript, the small insula cluster centered at [-28 24 -4] and shown in Figure 4F survived corrections for multiple tests within the anatomically-defined anterior insula (based on the anatomical maximum probability map described in Faillenot et al., 2017), which is independent of the result of our analysis. Functionally defining the small volume based on the same data would indeed be circular and misleading “double-dipping”. We have most certainly NOT done this. The reason why we selected the anterior insula is because it is one of the regions most frequently associated with guilt (see the explanations in our Introduction, which refers for example to Bastin et al., 2016; Lamm & Singer, 2010; Piretti et al., 2023). Thus we feel that performing small-volume correction within the anatomically-defined anterior insula is a valid analysis. We fully acknowledge that, independently of any correction, the effect and the cluster are small. We now write:

      “We found a weak response in a small cluster within the left anterior insula (peak T = 3.95, d = 0.59, 22 voxels, peak intensity at [-28 24 -4]; Figure 4F). Given the documented association between anterior insula and guilt (see Introduction), we proceeded to test whether this result survived correction for family-wise errors due to multiple comparisons restricted to the left anterior insula gray matter [defined anatomically and thus independently from our findings, as the anterior short gyrus, middle short gyrus, and anterior inferior cortex in an anatomical maximum probability map (Faillenot et al., 2017)]. This correction resulted in a p value of 0.024. This result, although it is only a small effect in a small cluster, is consistent with the mixed model analysis reported earlier.”

      Reviewer #2 (Public review):

      Summary

      This manuscript focuses on the role of social responsibility and guilt in social decision-making by integrating neuroimaging and computational modeling methods. Across two studies, participants completed a lottery task in which they made decisions for themselves or for a social partner. By measuring momentary happiness throughout the task, the authors show that being responsible for a partner's bad lottery outcome leads to decreased happiness compared to trials in which the participant was not responsible for their partner's bad outcome. At the neural level, this guilt effect was reflected in increased neural activity in the anterior insula, and altered functional connectivity between the insula and the inferior frontal gyrus. Using computational modeling, the authors show that trial-by-trial fluctuations in happiness were successfully captured by a model including participant and partner rewards and prediction errors (a 'responsibility' model), and model-based neuroimaging analyses suggested that prediction errors for the partner were tracked by the superior temporal sulcus. Taken together, these findings suggest that responsibility and interpersonal guilt influence social decision-making.

      Strengths

      This manuscript investigates the concept of guilt in social decision-making through both statistical and computational modeling. It integrates behavioral and neural data, providing a more comprehensive understanding of the psychological mechanisms. For the behavioral results, data from two different studies is included, and although minor differences are found between the two studies, the main findings remain consistent. The authors share all their code and materials, leading to transparency and reproducibility of their methods.

      The manuscript is well-grounded in prior work. The task design is inspired by a large body of previous work on social decision-making and includes the necessary conditions to support their claims (i.e., Solo, Social, and Partner conditions). The computational models used in this study are inspired by previous work and build on well-established economic theories of decision-making. The research question and hypotheses clearly extend previous findings, and the more traditional univariate results align with prior work.

      The authors conducted extensive analyses, as supported by the inclusion of different linear models and computational models described in the supplemental materials. Psychological concepts like risk preferences are defined and tested in different ways, and different types of analyses (e.g., univariate and multivariate neuroimaging analyses) are used to try to answer the research questions. The inclusion and comparison of different computational models provide compelling support for the claim that partner prediction errors indeed influence task behavior, as illustrated by the multiple model comparison metrics and the good model recovery.

      We thank the reviewer very much for their comprehensive description of our study and the positive assessment of our study and approach.

      Weaknesses

      As the authors already note, they did not directly ask participants to report their feelings of guilt. The decrease in happiness reported after a bad choice for a partner might thus be something else than guilt, for example, empathy or feelings of failure (not necessarily related to guilt towards the other person). Although the patterns of neural activity evoked during the task match with previously found patterns of guilt, there is no direct measure of guilt included in the task. This warrants caution in the interpretation of these findings as guilt per see.

      We fully agree that not directly asking participants about feelings of guilt is a clear limitation of our study. While we already mention this in our Discussion, we have expanded our discussion of the consequences on the interpretation of our results along the lines described by the reviewer in the revised manuscript. We would like to thank the reviewer for proposing these lines of thought, and have now made the following changes to the text:

      In the first paragraph of the discussion, we now write: “Being responsible for choosing a lottery that yielded a low outcome for a partner made our participants feel worse than witnessing the same outcome resulting from their partner’s choice, which we interpret as interpersonal guilt; although we note that we have not asked participants specifically about which emotion they felt in these situations.

      Later on, in the third paragraph focusing on the anterior insula, we now write: “This replicates a large body of evidence associating aIns with feelings of guilt evoked during social decisions (see Introduction). Because we have neither asked our participants specifically what they felt in these situations, nor specifically whether they experienced guilt, we cannot exclude the possibility that they have instead or in addition felt empathy for their partner, a feeling of failure or bad luck, or some other emotion.”

      As most comparisons contrast the social condition (making the decision for your partner) against either the partner condition (watching your partner make their decision) or the solo condition (making your own decision), an open question remains of how agency influences momentary happiness, independent of potential guilt. Other open questions relate to individual differences in interpersonal guilt, and how those might influence behavior.

      How agency influences momentary happiness or variations thereof during the course of an experiment such as ours is an interesting question in itself. We now ran linear mixed models assessing agency (i.e. we compared happiness in conditions Solo & Social conditions vs. Partner condition), which revealed lower happiness in Solo and Social conditions (i.e. when it was the participant’s turn to decide) in both studies. This is interesting in itself and may reflect the drive behind responsibility aversion reported by Edelson et al.’s 2018 study: being assigned the role of the decider in a social setting may make people slightly unhappy, perhaps due to “weight of the responsibility”. We now report these findings in the Results section, including this proposed explanation; because we were not specifically interested in responsibility aversion, we do not discuss this further in the Discussion. The edited text is under the new subsection entitled ‘Momentary happiness: effects of agency, responsibility and guilt’, on page 12:

      “Next, we assessed whether happiness varied depending on the participant’s agency (Social + Solo vs. Partner), and found happiness to be lower when the participant chose, independent of the outcome (Study 1: t(3600) = -3.92, p = 0.00009, β = -0.14, 95% CI = [-0.20 -0.07]; Study 2: t(2870) = -6.07, p = 0.000000001, β = -0.24, 95% CI = [-0.31 -0.16]). . This is interesting in itself and may reflect the drive behind responsibility aversion reported by Edelson et al.’s 2018 study: being assigned the role of the decider in a social setting may make people slightly unhappy, perhaps due to “weight of the responsibility”. To specifically search for a sign of interpersonal guilt, [...]”

      Regarding individual differences: this is a very interesting topic that we have not addressed here due to the (relatively) small number of participants in our studies, but we might consider this for future follow-up studies, which we mention in the Discussion paragraph regarding open questions.

      This manuscript is an impressive combination of multiple approaches, but how these different approaches relate to each other and how they can aid in answering slightly different questions is not very clearly described. The authors could improve this by more clearly describing the different methods and their added value in the introduction, and/or by including a paragraph on implications, open questions, and future work in the discussion.

      We thank the reviewer for their appreciation of our complementary approach, and agree that we had not sufficiently explained the reasons why we used several methods. We have now added a paragraph explaining this at the end of the Introduction (page 5):

      “We analysed our behavioural data using several complementary methods: choices were modelled with mixed-effects regressions serving as manipulation checks; risk preferences expressed in choices were assessed using a comprehensive expected utility model as well as with a simpler, more robust “risk premium” approach; and happiness data were fitted, in addition to the computational models, with several linear mixed models to assess the impact of both the participant’s and their partner’s rewards, the impact of agency and their interactions. Inspired by findings reported in previous neuroimaging of social emotions, we also used several methods to analyse our fMRI data, including conventional methods (both region-of-interest and mass univariate); mixed-effects regression models; computational model-based analyses (inspired by e.g. Konovalov et al., 2021; Rutledge et al., 2014); and functional connectivity (e.g. Edelson et al., 2018; Konovalov et al., 2021). The behavioural modelling is thus complemented by neuroimaging analyses that offer insight about both the activity in regions associated with guilt as well as their place in a wider network, providing an in-depth comprehensive analysis of the mechanisms behind guilt evoked by social responsibility.”

      In addition, as suggested we added the following paragraph on open questions and future work in the Discussion:

      “Several open questions remain at the end of this study. As discussed above, asking participants directly about which emotions they have felt during the different stages of this task would allow us to link subjective experience with our analytical measures. Testing more participants would allow us to assess the impact of inter-individual variations in personality traits on the experience as well as the behavioural and neural correlates of guilt and responsibility. Using more trials in the experiment would allow separate modelling of risk preferences in gain and loss trials in each experimental condition using expected utility models, and could allow testing whether changes in momentary happiness affect subsequent choices. Varying partner identities (friends, strangers, artificial agent) could reveal the impact of social discounting on guilt and responsibility. In sum, we believe that this experimental approach lends itself very well to the study of several aspects of social emotions.”

      However, taken together, this study provides useful insights into the neural and behavioral mechanisms of responsibility and guilt in social decision-making and how they influence behavior. 

      We thank the reviewer again for their appreciation of our work and hope that our revisions improved the manuscript.

      Recommendations for the authors:

      Reviewer #1 (Recommendations for the authors):

      The majority of my suggestions are in the public review, so I will not repeat them here. But in general, I like the paper, and in addition to my other comments, I think that there should be more discussion of the potential limitations of the study and conclusions that can be drawn. I also thought parts of the results were a little hard to follow, particularly in the 'momentary happiness' section. Perhaps an additional subsection here might help with flow.

      We agree that we could have discussed further the limitations of our study and the conclusions that can be drawn from it, which we have now done in the last paragraphs of the Discussion in this revised version.

      To improve the structure of the section on ‘momentary happiness’, we separated this section into two, entitled: ‘Momentary happiness: links to reward‘ and ‘Momentary happiness: effects of agency, responsibility and guilt’, which should facilitate the reading of this long section. We proceeded in a similar manner for the Choices section, which is now subdivided into ‘Choices: manipulation check’ and ‘Choices: risk preferences’. We believe that these changes have indeed improved the readability of our manuscript.

      Reviewer #2 (Recommendations for the authors):

      Overall, I believe this manuscript was well-designed, consists of extensive analyses, and provides interesting new insights into the mechanisms underlying social decision-making. I mostly have some clarifying questions and minor comments, which are described below. 

      (1) Integration of prior findings in the first paragraphs of the Introduction. Although all the previous work described in the 2nd-5th paragraph introduction is interesting, it felt a bit like an enumeration of findings rather than an integrated introduction leading to the current research question. At the end of paragraph 5, it becomes clear how these findings relate to the current research question, but I believe it will improve the flow and readability of the introduction if this becomes clear earlier on.

      We agree that we could have integrated the cited previous work into the Introduction so that the text builds up to the research question. We have now extensively reworked several paragraphs in the Introduction (pages 3-5) and hope that these changes have made it easier to follow.

      (2) For the risk attitudes (Choices), you describe pooling the gains and losses and then comparing the social and solo conditions. I was wondering whether you also looked at potential differences between gains and losses (delta measure) for social versus the solo condition (so a comparison of the delta). Based on prior work, I can imagine that the difference in risk attitudes for gains and losses might differ when making decisions for yourself versus when you're doing it for a partner. In general, I was wondering how you explain these findings, as there is also a lot of work showing differences in risk-taking patterns for gains and losses.

      We agree that we could have compared delta measures between solo and social conditions. However, as we describe in the Results section and comment on in the Discussion, the relatively low number of trials made separate fitting of gain and loss trials across conditions difficult. While this question could thus be addressed in subsequent versions of our experiment with more trials, such a fine-grained analysis of the decisions was not the focus of our current study.

      (3) On page 11, you state: "in particular the partner's reward prediction errors resulting from the participants' decisions, i.e. those pRPE for which participants were responsible." From the results described in the paragraph above, this doesn't become clear (e.g., there's no distinction made between social_pRPE and partner_pRPE in the text), as it only discusses differences in weights between pRPE and sRPE. I would recommend including some more information in the main text on these main modeling findings, so one doesn't have to go to the Supplemental Materials to understand them.

      We did indeed fail to report these findings in the text! We thank the reviewer for pointing this out. We have now edited this passage as follows:

      “Crucially, we find here that the partner’s reward prediction errors (social_pRPE and partner_pRPE) contributed to explaining changes in participants’ momentary happiness: the Responsibility and ResponsibilityRedux models explained the data better than the models without these parameters (see Table 1). In particular, the partner’s reward prediction errors resulting from the participants’ decisions (social_pRPE), i.e. those pRPE for which participants were responsible, contributed to explaining our data (weights for social_pRPE were greater than 0: Responsibility model: Study 1: Z = 2.85, p = 0.004, Study 2: Z = 3.26, p = 0.001; Responsibility Redux model: Study 1: Z = 2.93, p = 0.003, Study 2: Z = 3.30, p = 0.001; weights for social_pRPE tended to be higher than weights for partner_pRPE: Responsibility model: Study 1: Z = 2.14, p = 0.033; Study 2: Z = 1.41, p = 0.16).”

      (4) The functional connectivity findings seem to come out of nowhere and are not introduced or described anywhere prior in the manuscript. It is therefore not completely clear why you conducted these analyses, or what they add above and beyond previous analyses. Already introducing this method earlier on would fix that.

      We agree that we could have introduced functional connectivity analyses earlier in the text, particularly given the many previous studies in our field using this technique. We have now done this at the end of a new last paragraph of the Introduction:

      “Inspired by findings reported in previous neuroimaging of social emotions, we also used several methods to analyse our fMRI data, including conventional methods (both region-of-interest and mass univariate); mixed-effects regression models; computational model-based analyses (inspired by e.g. Konovalov et al., 2021; Rutledge et al., 2014); and functional connectivity (e.g. Edelson et al., 2018; Konovalov et al., 2021). The behavioural modelling is thus complemented by neuroimaging analyses that offer insight about both the activity in regions associated with guilt as well as their place in a wider network, providing an in-depth comprehensive analysis of the mechanisms behind guilt evoked by social responsibility.”

      (5) For the functional connectivity findings: I was wondering why you only looked at the choice phase, and not at the feedback phase. I understand that previous work focused on the choice phase, but for the purpose of this study (focus on guilt), I can imagine it is also interesting to see what happens with feedback. In the discussion, you also state "How we feel when we witness our decisions' consequences on others is an important signal to consider when attempting to make good social decisions." (p. 19), which is more focused on the feedback rather than choice, and also supports the idea that looking at the feedback moment might be relevant.

      We agree that we could also have looked at the functional connectivity during the feedback phase. The main reason why we had originally not done so was time constraints. At the current time we would in addition point out that the manuscript is already very long and contains many analyses of behavioural and fMRI data. Adding this analysis would cost additional time and would further delay the publication of our manuscript, which we would prefer to avoid. However, one could of course look at these effects in subsequent analyses of the same data or in subsequent versions of this experiment. We have now mentioned this in the Discussion, in the paragraphs on open questions.

      Minor comments:

      (1) For some of the Figures, it would be helpful if the subtitles were more informative. For Figure 2 and Figure 3 for example, it would be nice if Study 1 and Study 2 were not only mentioned in the figure description but also in the actual figure. For Figures 3 and 4, it would be helpful to have significance stars for the bar plots as well.

      We agree that these changes make the figures more easily understandable and have implemented them all, except for adding stars on Figure 4, because all bar plots in panels C and E would have been labeled with two or more stars, which would have made the figure difficult to read. We have now mentioned the fact that all these coefficients were significant in the figure legend.

      (2) For some of the Supplementary Results, it would be very helpful if there was a legend or description. This is already the case for most of the SR, but not for all.

      We have now added a legend to all elements of the Supplementary Results.

      Some questions that came to mind while going through them:

      - Supplementary Table 1: which p-values correspond to the significance stars? This information is included for Supplementary Table 2, but not for ST1. 

      We have now added the missing information in ST1.

      - Supplementary Figure 1: do the colors correspond to different participants? 

      We have now specified that the colors do indeed correspond to different participants.

      - Supplementary Table 5 (final table): what do the - represent? As in, why is there no value for "run" for the MPFC? At first, I thought you only included the significant values, but then I noticed a few non-significant values as well, so it wasn't completely clear to me why some of the values were missing. This also applies to Supplementary Table 6.

      We have indeed forgotten to explain this. The ‘-’ in Supplementary Tables 4 and 6 indicate that the linear mixed model without the factor ‘run’ was the better-fitting one. We have now added the following explanation in the text accompanying Supplementary Table 4:

      “We tested these models both with and without the factor Run and associated interaction, and we report the best-fitting model in the table below: a dash (‘-’) in the row displaying parameters for the run and socialVsSolo:run regressors indicates that the model without factor run was better-fitting for this ROI.”

      (3) I came across a few minor typos or sentences that were not completely clear to me.

      - On page 3: "Patients with damage to ventromedial prefrontal cortex (vmPFC) seem insensitive to guilt when playing social economic games (Krajbich et al., 2009)." This sentence felt a bit out of nowhere and doesn't logically follow from the previous sentences. 

      We have now revised the descriptions of this previous study as well as several others and how they fit into the research question.

      - On page 3: "In another study, participant errors in a difficult perception task lead to a partner feeling pain and evoked activations in left aIns and dlPFC (Koban et al., 2013)." This sentence doesn't really flow, and from the wording, it is not completely clear whether it's the errors or the partner pain that led to the aIns and dlPFC activation.

      We have now revised the description of this study as well, as follows:

      “In another study, partners received painful stimuli when participants made errors during a difficult perception task. These errors evoked activations in the left aIns and dlPFC in the participants (Koban et al., 2013).”

      - Supplementary Figure 1: there is a missing period after the sentence "We then compared these new estimated parameters to the actual parameters from which the synthetic data were generated"

      We have now added a missing comma after “generated”.

      - On page 5: "We ran two experiments, Study 1 outside fMRI and Study 2 during fMRI, with separate groups of participants." I would change "outside fMRI" to outside the MRI scanner or something like that, as it's not completely correct to say "outside fMRI".

      We have changed the sentence to “outside the MRI scanner”.

      - On page 6: for the first result, there are currently two p-values reported (p < 2.5e-20 and p < 2e-16). I believe this is an error?

      This was indeed an error! We have re-run this analysis, noticed that also the degrees of freedom were miscalculated, and have updated this result and the effect of condition (solo vs social). Results are almost identical as previously and all conclusions hold. We have also checked the other analyses reported in this paragraph – all results replicate exactly.

      - On page 6: "Supplemental Table 1" should be "Supplementary Table 1" (for consistency).

      Done.

      On page 8: "participants in both conditions of both studies", I would change "of both studies" to "for both studies".

      Done.

      On page 8: for the "Momentary Happiness" paragraph, it would be helpful if you could briefly describe the Rutledge method here, for people who are unfamiliar with the approach.

      We now write the following at the beginning of this paragraph:

      “Following Rutledge and colleagues’ methodology, which considers that changes in momentary happiness in response to outcomes of a probabilistic reward task are explained by the combined influence of recent reward expectations and prediction errors arising from those expectations, we fitted computational models to each participant’s happiness data.”

      On page 10: "Wilkoxon sign-rank tests", should be "Wilcoxon".

      Done.

      We thank the reviewer for their careful reading of our manuscript. We believe that these changes have indeed improved our manuscript.

    1. eLife Assessment

      This study investigates how RNA molecules modulate phase separation, aggregation, and cytotoxicity of the staphylococcal virulent peptide PSMα3 and the human host‑defence peptide LL‑37 using an array of biophysical and cell‑based assays. If validated, these findings would be important, as they suggest that nucleic acids can tune the material state and bioactivity of amyloids, with implications for host-pathogen interactions and for the design of therapeutics that target phase behaviour. However, the evidence is incomplete: many key claims rest on qualitative imaging and contested assumptions about "functional" amyloids, and the absence of quantitative binding data, phase diagrams, and appropriate controls limits confidence in the conclusions.

    2. Reviewer #1 (Public review):

      Summary:

      The manuscript by Rayan et al. aims to elucidate the role of RNA as a context-dependent modulator of liquid-liquid phase separation (LLPS), aggregation, and bioactivity of the amyloidogenic peptides PSMα3 and LL-37, motivated by their structural and functional similarities.

      Strengths:

      The authors combine extensive biophysical characterization with cell-based assays to investigate how RNA differentially regulates peptide aggregation states and associated cytotoxic and antimicrobial functions.

      Weaknesses:

      While the study addresses an interesting and timely question with potentially broad implications for host-pathogen interactions and amyloid biology, several aspects of the experimental design and data analysis require further clarification and strengthening.

      Major Comments:

      (1) In Figure 1A, the author showed "stronger binding affinity" based on shifts at lower peptide concentrations, but no quantitative binding parameters (e.g., apparent Kd, fraction bound, or densitometric analysis) are presented. This claim would be better supported by including: (i) A binding curve with quantification of free vs bound RNA band intensities (ii) Replicates and error estimates (mean {plus minus} SD).

      (2) The authors report droplet formation at low RNA (50 ng/µL) but protein aggregation at high RNA (400 ng/µL) through fluorescence microscopy. However, no intermediate RNA concentrations (e.g., 100-300 ng/µL) are tested or discussed, leaving a critical gap in understanding the full phase diagram and transition mechanisms. Additionally, the behaviour of PSMα3 in the absence of RNA under LLPS conditions is not shown. Without protein-only data, it is difficult to assess if droplets are RNA-induced or if protein has a weak baseline LLPS that RNA tunes. The saturation concentration (csat) for PSMα3 phase separation, either in the absence or presence of RNA, should be reported.

      (3) For a convincing LLPS claim, it is important to show: Quantitative FRAP curves (mobile fraction and half-time of recovery) rather than only microscopy images and qualitative statements.

      (4) The manuscript highly relies on fluorescence microscopy to show colocalization. However, the colocalization is presented in a qualitative manner only. The manuscript would benefit from the inclusion of quantitative metrics (e.g., Pearson's correlation coefficient, Manders' overlap coefficients, or intensity correlation analysis).

      (5) In Figures 3 B and 3C, the contrast between "no AT630 at 30 min, strong at 2 h" (50 ng/μL) and "strong at 30 min" (400 ng/μL) is compelling, but a simple quantification (e.g., mean fluorescence intensity per area) would greatly increase rigor.

      (6) In Figure S3 ssCD data, if possible, indicate whether the α-helical signal increases with RNA concentration or shows a non-linear dependence, which might link to the LLPS vs solid aggregate regimes.

      (7) In Figure 5B, FRAP recovery in dying cells may reflect artifactual mobility rather than biological relevance. Additionally, the absence of quantification data limits interpretation; providing recovery curves would clarify relevance.

      (8) The narrative conflates cytotoxicity endpoints (membrane damage, PI staining, aggregates) with localization data (nucleolar foci), creating ambiguity about whether nucleolar targeting drives toxicity or is a consequence of cell death. Separating toxicity assessment from localization analysis, or clearly demonstrating that nucleolar accumulation precedes cytotoxicity, would resolve this ambiguity.

      (9) In Figure 8, to strengthen the LLPS assignment for LL-37, additional evidence, such as FRAP analysis or observation of droplet fusion events, would be valuable. This is particularly relevant given that the heat shock conditions (65{degree sign}C for 15 minutes) could potentially induce partial denaturation or nonspecific coacervation.

    3. Reviewer #2 (Public review):

      In this paper, Rayan et al. report that RNA influences cytotoxic activity of the staphylococcal secreted peptide cytolysin PSMalpha3 versus human cells and E. coli by impacting its aggregation. The authors used sophisticated methods of structural analysis and described the associated liquid-liquid phase separation. They also compare the influence of RNA on the aggregation and activity of LL-37, which shows differences from that on PSMalpha3.

      Strengths:

      That RNA impacts PSM cytotoxicity when co-incubated in vitro becomes clear.

      Weaknesses:

      I have two major and fundamental problems with this study:

      (1) The premise, as stated in the introduction and elsewhere, that PSMalpha3 amyloids are biologically functional, is highly debatable and has never been conclusively substantiated. The property that matters most for the present study, cytotoxicity, is generally attributed to PSM monomers, not amyloids. The likely erroneous notion that PSM amyloids are the predominant cytotoxic form is derived from an earlier study by the authors that has described a specific amyloid structure of aggregated PSMalpha3. Other authors have later produced evidence that, quite unsurprisingly, indicated that aggregation into amyloids decreases, rather than increases, PSM cytotoxicity. Unfortunately, yet other groups have, in the meantime, published in-vitro studies on "functional amyloids" by PSMs without critically challenging the concept of PSM amyloid "functionality". Of note, the authors' own data in the present study, which show strongly decreased cytotoxicity of PSMalpha3 after prolonged incubation, are in agreement with monomer-associated cytotoxicity as they can be easily explained by the removal of biologically active monomers from the solution.

      (2) That RNA may interfere with PSM aggregation and influence activity is not very surprising, given that PSM attachment to nucleic acids - while not studied in as much detail as here - has been described. Importantly, it does not become clear whether this effect has biologically significant consequences beyond influencing, again not surprisingly, cytotoxicity in vitro. The authors do show in nice microscopic analyses that labeled PSMalpha3 attaches to nuclei when incubated with HeLa cells. However, given that the cells are killed rapidly by membrane perturbation by the applied PSM concentrations, it remains unclear and untested whether the attachment to nucleic acids in dying cells makes any contribution to PSM-induced cell death or has any other biological significance.

      Overall, the findings can be explained in a much more straightforward way with the common concept of cytotoxicity being due to monomeric PSMs, and the impact of nucleic acids on cytotoxicity being due to lowering of the concentration of that active form by RNA attachment. Further limiting the significance of the findings, whether this interaction has any biological significance on the physiology or infectivity of the PSM producer remains largely unexplored.

    4. Reviewer #3 (Public review):

      Summary:

      The manuscript by Rayan et al. aims to investigate the role of RNA in modulating both virulent amyloid and host-defense peptides, with the objective of understanding their self-assembly mechanisms, morphological features, and aggregation pathways.

      Strengths:

      The overall content is well-structured with a logical flow of ideas that effectively conveys the research objectives.

      Weaknesses:

      (1) Figure 2 displays representative FRAP images demonstrating fluorescence recovery within seconds. To gain a more comprehensive understanding of how recovery after photobleaching varies under different conditions, it is recommended to supplement these images with corresponding quantitative fluorescence recovery curves for analysis.

      (2) Ostwald ripening typically leads to the shrinkage or even disappearance of smaller droplets, accompanied by the further growth of large droplets. However, the droplet size in Figure 2D decreases significantly after 2 h of incubation. This observation prompts the question, what is the driving force underlying RNA-regulated phase separation and phase transition?

      (3) The manuscript aims to study the role of RNA in modulating PSMα3 aggregation by using solution-state NMR to obtain residue-specific structural information. The current NMR data, as described in the method and figure captions, were recorded in the absence of RNA. Whether RNA binding induces conformational changes of PSMα3, and how these changes alter the NMR spectra? Also, the sequential NOE walk between neighboring residues can be annotated on the spectrum for clarity.

      (4) The authors claim that LL-37 shares functional, sequence, and structural similarities with PSMα3. However, no droplet formation was observed of LL-37 in the presence of RNA only. The authors then applied thermal stress to induce phase separation of LL-37. What are the main factors contributing to the different phase behaviors exhibited by LL-37 and PSMα3? What are the differences in the conformation of amyloid aggregates and the kinetics of aggregation between the condensation-induced aggregation in the presence of RNA and the conventional nucleation-elongation process in the absence of RNA for these two proteins?

    5. Author response:

      We thank the reviewers for their thoughtful and constructive comments, which greatly helped us to clarify, quantify, and strengthen both our findings and interpretations. Below, we provide a point-by-point response to each comment and describe the corresponding changes made.

      Public Reviews:

      Reviewer #1 (Public review):

      Summary:

      The manuscript by Rayan et al. aims to elucidate the role of RNA as a context-dependent modulator of liquid-liquid phase separation (LLPS), aggregation, and bioactivity of the amyloidogenic peptides PSMα3 and LL-37, motivated by their structural and functional similarities.

      Strengths:

      The authors combine extensive biophysical characterization with cell-based assays to investigate how RNA differentially regulates peptide aggregation states and associated cytotoxic and antimicrobial functions.

      Weaknesses:

      While the study addresses an interesting and timely question with potentially broad implications for host-pathogen interactions and amyloid biology, several aspects of the experimental design and data analysis require further clarification and strengthening.

      Major Comments:

      (1) In Figure 1A, the author showed "stronger binding affinity" based on shifts at lower peptide concentrations, but no quantitative binding parameters (e.g., apparent Kd, fraction bound, or densitometric analysis) are presented. This claim would be better supported by including: (i) A binding curve with quantification of free vs bound RNA band intensities ,(ii) Replicates and error estimates (mean {plus minus} SD).

      We thank the reviewer for this suggestion. To quantitatively support the binding differences observed in Figure 1A, we have now performed densitometric analysis of the EMSA data and included the results in Figure S1. The analysis showed that the Kd for PSMα3 binding to polyAU and polyA RNA is in the same order of magnitude but lower for the polyAU, indicating a stronger binding. A description was added to the results in lines 137-145 of the revised version.

      (2) The authors report droplet formation at low RNA (50 ng/µL) but protein aggregation at high RNA (400 ng/µL) through fluorescence microscopy. However, no intermediate RNA concentrations (e.g., 100-300 ng/µL) are tested or discussed, leaving a critical gap in understanding the full phase diagram and transition mechanisms.

      Our initial choice of 50 ng/µL (low RNA) and 400 ng/µL (high RNA) was guided by a broader RNA titration performed by turbidity measurements across 0, 10, 20, 50, 100, 200, and 400 ng/µL (Figure S2 in the revised version). In this screen, turbidity increased up to 50 ng/µL and then decreased dose-dependently from 100–400 ng/µL. We interpret this non-monotonic behavior as consistent with a transition from a dropletrich regime (maximal light scattering at intermediate dense-phase volume) toward conditions where assemblies become larger and/or more compact and sediment out of the optical path. This is described in lines 158-161 of the revised version.

      Of note, additional intermediate RNA conditions (100 and 200 ng/µL) are included in Figure S14 (of the revised version). While these experiments were performed under the heat-shock perturbation, they nevertheless support the central point that RNA tunes assembly state across intermediate concentrations rather than producing a binary low/high outcome.

      Importantly, we agree with the reviewer that a full phase diagram would be the most rigorous way to define the transition mechanism. However, establishing csat and constructing a complete phase diagram would require systematic measurements of dilute-phase concentrations (e.g., centrifugation/quantification or fluorescence calibration), controlled ionic strength titrations, and time-resolved mapping, which is beyond the scope of the present study. We have therefore revised the text to avoid implying that we provide a complete phase diagram. Instead, we frame our results as a qualitative with multi-assay characterization showing that RNA concentration drives a shift from liquid-like condensates (at low RNA) toward solid-like assemblies (at high RNA), with an intermediate regime suggested by the turbidity transition and supported by additional imaging under stress. Finally, to address the “critical gap” concern directly, we add a sentence (lines 239-241) stating that: “Future work will be required to quantitatively define the phase boundaries and delineate the dominant mechanisms, such as sedimentation, dissolution, or coarsening/aging, across intermediate RNA concentrations.

      (3) Additionally, the behaviour of PSMα3 in the absence of RNA under LLPS conditions is not shown. Without protein-only data, it is difficult to assess if droplets are RNA-induced or if protein has a weak baseline LLPS that RNA tunes. The saturation concentration (csat) for PSMα3 phase separation, either in the absence or presence of RNA, should be reported.

      In response to the reviewer’s request, we have added Figure 2F, which shows PSMα3 alone in the absence of RNA under the same conditions. PSMα3 does not form droplets in this condition, indicating that condensate formation is RNA-dependent in the tested conditions. This is referred to in the text in lines 190-193 of the revised version. Please see our response about determining the csat in the response to the previous comment.

      (4) For a convincing LLPS claim, it is important to show: Quantitative FRAP curves (mobile fraction and half-time of recovery) rather than only microscopy images and qualitative statements.

      We have included quantitative FRAP analysis in Figure S4 of the revised version, showing normalized recovery curves along with extracted mobile fractions and half-times of recovery (t₁/₂). These quantitative measurements support the dynamic nature of the PSMα3–RNA. This is referred to in the text in lines 179-184 of the revised version.

      (5) The manuscript highly relies on fluorescence microscopy to show colocalization. However, the colocalization is presented in a qualitative manner only. The manuscript would benefit from the inclusion of quantitative metrics (e.g., Pearson's correlation coefficient, Manders' overlap coefficients, or intensity correlation analysis).

      In response, we have added quantitative colocalization analysis to the revised manuscript. Specifically, we now report Pearson’s correlation coefficients and Manders’ overlap coefficients for the dual-channel fluorescence microscopy datasets in Figure S5 of the revised version. These metrics provide an objective measure of codistribution and complement the qualitative imaging.

      The analysis supports that at low RNA concentrations (droplet/condensate conditions), PSMα3 and RNA show strong colocalization, consistent with RNA being incorporated within, or closely associated with, the peptide-rich phase. In contrast, at high RNA concentrations, where the assemblies are more solid-like/amyloid-positive, the quantitative coefficients decrease, consistent with reduced overlap and an apparent spatial demixing in which RNA becomes partially excluded from the peptide-rich structures. This is referred to in the text in lines 194-203 of the revised version.

      (6) In Figures 3 B and 3C, the contrast between "no AT630 at 30 min, strong at 2 h" (50 ng/μL) and "strong at 30 min" (400 ng/μL) is compelling, but a simple quantification (e.g., mean fluorescence intensity per area) would greatly increase rigor.

      We have included quantitative analysis of AmyTracker630 fluorescence intensity in Figure S6 of the revised version, reporting the mean fluorescence intensity per area for the indicated conditions and time points. This quantification supports the qualitative differences observed in Figures 3B and 3C. This is now referred to in the text in lines 233-236 of the revised version.

      (7) In Figure S3 ssCD data, if possible, indicate whether the α-helical signal increases with RNA concentration or shows a non-linear dependence, which might link to the LLPS vs solid aggregate regimes.

      The ssCD spectra displayed in Figure S7 in the revised version (corresponding to Figure S3 in the original submission) show that the α-helical signature of PSMα3 is markedly enhanced in the presence of RNA compared to peptide alone, as evidenced by increased signal intensity, deeper minima, and more pronounced spectral features characteristic of α-helical structure. Importantly, this enhancement is more pronounced at 400 ng/µL Poly(AU) RNA than at 50 ng/µL, particularly after 2 hours of coincubation, indicating that RNA concentration influences the stabilization of α-helical assemblies. This is now more specifically detailed in the text in lines 258-263 of the revised version.

      We note that solid-state CD does not allow direct quantitative deconvolution of secondary structure content (e.g., % helix) in the same manner as solution CD, due to sample anisotropy, scattering, and orientation effects inherent to dried or aggregated films. Consequently, our interpretation is qualitative rather than strictly quantitative. The ssCD data therefore suggest a non-linear dependence on RNA concentration, rather than a simple linear dose–response. This is also expected considering that phase transition, suggested by the other findings, is intrinsically non-linear.

      (8) In Figure 5B, FRAP recovery in dying cells may reflect artifactual mobility rather than biological relevance. Additionally, the absence of quantification data limits interpretation; providing recovery curves would clarify relevance.

      We added quantitative FRAP analysis of the effect on PSMα3 within HeLa cells, shown in Figure S8 of the revised version. Compared to PSMα3 assemblies in vitro, nucleolar PSMα3 exhibits slower fluorescence recovery and a reduced mobile fraction. The nucleolus represents a highly crowded, RNA-rich cellular environment, which is expected to impose additional constraints on molecular mobility and likely contributes to the slower recovery kinetics observed in cells. This is now more specifically detailed in the text in lines 324-333 and discussed in lines 597-607 of the revised version.

      (9) The narrative conflates cytotoxicity endpoints (membrane damage, PI staining, aggregates) with localization data (nucleolar foci), creating ambiguity about whether nucleolar targeting drives toxicity or is a consequence of cell death. Separating toxicity assessment from localization analysis, or clearly demonstrating that nucleolar accumulation precedes cytotoxicity, would resolve this ambiguity.

      We thank the reviewer for raising this important point. We agree that, in the current dataset, cytotoxicity readouts (membrane damage, PI staining, aggregate formation) and subcellular localization (nucleolar accumulation) are observed in close temporal proximity, which limits our ability to unambiguously assign causality. In the experiments presented here, PSMα3 was applied at concentrations known to induce rapid membrane disruption and cytotoxicity in HeLa cells. Under these conditions, PSMα3 accumulates on cellular membranes and penetrates into the cell and nucleus on very short timescales (seconds to minutes), likely preceding the temporal resolution accessible by standard live-cell fluorescence microscopy. As a result, nucleolar accumulation and cytotoxic endpoints are detected essentially concurrently, precluding a definitive determination of whether nucleolar association actively drives toxicity or occurs as a downstream consequence of membrane permeabilization and cell damage.

      We therefore emphasize that, in this study, nucleolar localization is presented as a phenomenological observation consistent with RNA-rich compartment association, rather than as a demonstrated causal mechanism of cytotoxicity. We have revised the Discussion (lines 597-607) to clarify this distinction and to avoid implying that nucleolar targeting is the primary driver of cell death.

      We agree that resolving this ambiguity would require systematic time-resolved and concentration-dependent experiments, including analysis at sub-toxic PSMα3 concentrations below the membrane-disruptive threshold, combined with orthogonal imaging approaches. Such experiments are planned for future work but are beyond the scope of the present study.

      (10) In Figure 8, to strengthen the LLPS assignment for LL-37, additional evidence, such as FRAP analysis or observation of droplet fusion events, would be valuable. This is particularly relevant given that the heat shock conditions (65 °C for 15 minutes) could potentially induce partial denaturation or nonspecific coacervation.

      In response to this comment, we have added FRAP analysis of LL-37 assemblies in the revised manuscript (Figure S12), including representative images and corresponding fluorescence recovery curves. The FRAP measurements show minimal fluorescence recovery over the acquisition window, indicating that the LL-37–RNA assemblies formed under these conditions are largely immobile and solid-like, rather than liquid-like droplets. This is now referred to in the text in lines 458-462 of the revised version.

      Reviewer #2 (Public review):

      In this paper, Rayan et al. report that RNA influences cytotoxic activity of the staphylococcal secreted peptide cytolysin PSMalpha3 versus human cells and E. coli by impacting its aggregation. The authors used sophisticated methods of structural analysis and described the associated liquid-liquid phase separation. They also compare the influence of RNA on the aggregation and activity of LL-37, which shows differences from that on PSMalpha3.

      Strengths:

      That RNA impacts PSM cytotoxicity when co-incubated in vitro becomes clear.

      Weaknesses:

      I have two major and fundamental problems with this study:

      (1) The premise, as stated in the introduction and elsewhere, that PSMalpha3 amyloids are biologically functional, is highly debatable and has never been conclusively substantiated. The property that matters most for the present study, cytotoxicity, is generally attributed to PSM monomers, not amyloids. The likely erroneous notion that PSM amyloids are the predominant cytotoxic form is derived from an earlier study by the authors that has described a specific amyloid structure of aggregated PSMalpha3. Other authors have later produced evidence that, quite unsurprisingly, indicated that aggregation into amyloids decreases, rather than increases, PSM cytotoxicity. Unfortunately, yet other groups have, in the meantime, published in-vitro studies on "functional amyloids" by PSMs without critically challenging the concept of PSM amyloid "functionality". Of note, the authors' own data in the present study, which show strongly decreased cytotoxicity of PSMalpha3 after prolonged incubation, are in agreement with monomer-associated cytotoxicity as they can be easily explained by the removal of biologically active monomers from the solution.

      We thank the reviewer for this important critique and agree that direct cytotoxicity is most plausibly mediated by soluble PSM species, while extensive fibrillation generally reduces toxicity by depleting these forms, a conclusion supported by our data and by other studies (e.g., Zheng et al 2018 and Yao et al 2019). We do not propose mature amyloid fibrils as the primary toxic entities. Rather, we use the term functional amyloid in a regulatory sense, consistent with other biological amyloids whose fibrillar states modulate activity (e.g., hormone storage amyloids or RNA-binding proteins).

      In line with emerging findings, we interpret PSMα3 toxicity as arising from a dynamic assembly process rather than from a single static molecular species. We previously showed that PSMα3 forms cross-α fibrils that are thermodynamically and mechanically less stable than cross-β amyloids and readily disassemble upon heat stress, fully restoring cytotoxic activity (Rayan et al., 2023). This behavior contrasts with PSMα1, which forms highly stable cross-β fibrils that do not recover activity after heat shock, suggesting that the limited thermostability of PSMα3 is an evolved feature enabling reversible switching between inactive (stored) and active states.

      Consistent with this view, both PSMα1 and PSMα3 are cytotoxic in their soluble states, yet mutants unable to fibrillate lose activity, indicating that fibrillation is required but not itself the toxic end state (Tayeb-Fligelman et al., 2017, 2020; Malishev et al., 2018). Our other studies further show that cytotoxicity toward human cells correlates with inherent or lipid-induced α-helical assemblies, rather than with inert β-sheet amyloids (RagonisBachar et al., 2022, 2026; Salinas 2020, Bücker 2022). Together, these findings support a model in which membrane-associated, dynamic α-helical assembly, which requires continuous exchange between soluble species and growing fibrils, drives membrane disruption, potentially through lipid recruitment or extraction, analogous to mechanisms proposed for human amyloids such as islet amyloid polypeptide (Sparr et al., 2004).

      In the present study, we further show that RNA reshapes this dynamic landscape: while PSMα3 alone progressively loses activity upon incubation, co-incubation with RNA preserves cytotoxicity by stabilizing bioactive polymorphs and condensate-like states, whereas high RNA concentrations promote solid aggregation but nevertheless preserve activity. Thus, aggregation is neither inherently functional nor toxic, but context-dependent and environmentally regulated. Taken together, our data support a model in which PSMα3 amyloids act as a dynamic reservoir, enabling S. aureus to tune virulence by reversibly shifting between dormant and active states in response to environmental cues such as heat or RNA.

      This is now discussed in lines 56-76 and 523-553 of the revised version.

      (2) That RNA may interfere with PSM aggregation and influence activity is not very surprising, given that PSM attachment to nucleic acids - while not studied in as much detail as here - has been described. Importantly, it does not become clear whether this effect has biologically significant consequences beyond influencing, again not surprisingly, cytotoxicity in vitro. The authors do show in nice microscopic analyses that labeled PSMalpha3 attaches to nuclei when incubated with HeLa cells. However, given that the cells are killed rapidly by membrane perturbation by the applied PSM concentrations, it remains unclear and untested whether the attachment to nucleic acids in dying cells makes any contribution to PSM-induced cell death or has any other biological significance.

      We thank the reviewer for this important point and agree that PSM–nucleic acid interactions are not unexpected and that our data do not support a direct intracellular role for RNA binding in mediating cytotoxicity. Accordingly, we do not propose nucleolar or nuclear association of PSMα3 as a causal mechanism of cell death. At the concentrations used, PSMα3 induces rapid membrane disruption, and nucleic acid association is observed along with membrane attachment, precluding conclusions about intracellular function. This limitation is now explicitly clarified in the revised manuscript. The biological significance of our findings lies instead in extracellular and environmental contexts, where PSMα3 encounters abundant nucleic acids, such as RNA or DNA released from damaged host cells or present in biofilms as now addressed in lines 622631. Our data show that RNA modulates PSMα3 aggregation trajectories, shifting the balance between liquid-like condensates and solid aggregates, and thereby regulates the persistence and timing of cytotoxic activity. In this framework, RNA acts as a context-dependent regulator of virulence, rather than as an intracellular cytotoxic cofactor, an aspect which would be studied in depth in future work. This is now addressed in the text in lines 597-607 of the revised version.

      Reviewer #3 (Public review):

      Summary:

      The manuscript by Rayan et al. aims to investigate the role of RNA in modulating both virulent amyloid and host-defense peptides, with the objective of understanding their self-assembly mechanisms, morphological features, and aggregation pathways.

      Strengths:

      The overall content is well-structured with a logical flow of ideas that effectively conveys the research objectives.

      Weaknesses:

      (1) Figure 2 displays representative FRAP images demonstrating fluorescence recovery within seconds. To gain a more comprehensive understanding of how recovery after photobleaching varies under different conditions, it is recommended to supplement these images with corresponding quantitative fluorescence recovery curves for analysis.

      In response to this comment, we have supplemented the representative FRAP images with quantitative fluorescence recovery curves, reporting normalized recovery kinetics for the indicated conditions. These data are now provided in Figure S4 of the revised manuscript, allowing direct comparison of recovery behavior across conditions (shown by microscopy in Figure 2). In addition, we have included quantitative FRAP analyses for the cellular imaging shown in Figure 5 (presented in Figure S8) and for LL-37 assemblies formed under heat-shock conditions (Figure S12). Together, these additions provide a quantitative framework for interpreting the FRAP results and strengthen the distinction between liquid-like and solid-like assembly states.

      (2) Ostwald ripening typically leads to the shrinkage or even disappearance of smaller droplets, accompanied by the further growth of large droplets. However, the droplet size in Figure 2D decreases significantly after 2 h of incubation. This observation prompts the question, what is the driving force underlying RNA-regulated phase separation and phase transition?

      We thank the reviewer for this observation. Across multiple samples, we consistently observe a coexistence of small droplets and larger aggregates, rather than systematic growth of larger droplets at the expense of smaller ones or a uniform decrease in droplet size. In addition, the timescales examined do not allow us to reliably assess whether diffusion-driven droplet coalescence is fast enough to draw firm conclusions about droplet size evolution. This is now addressed in the text in lines 181-184 of the revised version.

      A decrease in droplet size over time is nevertheless observed in some instances and is more consistent with a time-dependent conversion of initially liquid-like condensates into more solid-like assemblies, which would reduce molecular mobility and suppress droplet coalescence. In parallel, progressive fibril formation may act as a sink for soluble peptide, leading to partial dissolution or shrinkage of less mature condensates. Together, these observations are consistent with a non-equilibrium aging process, in which RNAregulated assemblies evolve from dynamic condensates toward more solid structures rather than following equilibrium Ostwald ripening.

      (3) The manuscript aims to study the role of RNA in modulating PSMα3 aggregation by using solution-state NMR to obtain residue-specific structural information. The current NMR data, as described in the method and figure captions, were recorded in the absence of RNA. Whether RNA binding induces conformational changes of PSMα3, and how these changes alter the NMR spectra? Also, the sequential NOE walk between neighboring residues can be annotated on the spectrum for clarity.

      The solution-state NMR experiments were performed specifically to characterize the potential binding of EGCG to PSMα3. Due to the strong tendency of PSMα3 to undergo rapid aggregation and line broadening upon RNA addition, solutionstate NMR spectra in the presence of RNA could not be obtained at sufficient quality for residue-specific analysis. As suggested, we have updated and annotated the sequential NOE walk between neighboring residues on the relevant NOESY spectra to improve clarity.

      (4) The authors claim that LL-37 shares functional, sequence, and structural similarities with PSMα3. However, no droplet formation was observed of LL-37 in the presence of RNA only. The authors then applied thermal stress to induce phase separation of LL-37. What are the main factors contributing to the different phase behaviors exhibited by LL37 and PSMα3? What are the differences in the conformation of amyloid aggregates and the kinetics of aggregation between the condensation-induced aggregation in the presence of RNA and the conventional nucleation-elongation process in the absence of RNA for these two proteins?”

      We appreciate this important question and have clarified both the basis of the comparison and the origin of the divergent phase behaviors of LL-37 and PSMα3. While PSMα3 and LL-37 share key properties as short, cationic, amphipathic α-helical peptides that self-assemble and interact with nucleic acids, they differ fundamentally in their assembly architectures. PSMα3 is an amyloidogenic peptide that forms cross-α amyloid fibrils, in which α-helices stack perpendicular to the fibril axis. In contrast, LL-37 can form fibrillar or sheet-like assemblies (observed in cryo grids), but these lack canonical amyloid features without clear cross-α or cross-β amyloid order, as so far observed by crystal structures. This is now clarified in different parts of the text of the revised version. Thus, the comparison between the two peptides is functional and physicochemical rather than implying identical amyloid mechanisms. These structural differences likely underlie their distinct phase behaviors.

      Because LL-37 does not follow a classical amyloid nucleation–elongation pathway, and high-resolution structural information (e.g., cryo-EM) is currently lacking, partly due to its sheet-like, non-twisted morphology (unpublished results), it is not possible to directly compare aggregation kinetics or nucleation mechanisms between LL-37 and PSMα3. It is possible that amyloidogenic systems such as PSMα3 exhibit greater flexibility in prefibrillar and fibrillar polymorphism, enabling RNA-regulated phase behavior, whereas nonamyloid assemblies such as LL-37 are more prone to stress-induced solid aggregation. We note that this interpretation is necessarily tentative and does not imply a general rule, but rather reflects differences evident in the present system.

    1. eLife Assessment

      In this valuable study, the authors present traces of bone modification on ~1.8 million-year-old proboscidean remains from Tanzania, which they infer to be the earliest evidence for stone-tool-assisted megafaunal consumption by hominins. Challenging published claims, the authors argue that persistent megafaunal exploitation roughly coincided with the earliest Acheulean tools. Notwithstanding the rich descriptive and spatial data, the behavioral inferences about hominin agency rely on traces (such as bone fracture patterns and spatial overlap) that are not unequivocal; the evidence presented to support the inferences thus remains incomplete. Given the implications of the timing and extent of hominin consumption of nutritious and energy-dense food resources, as well as of bone toolmaking, the findings of this study will be of interest to paleoanthropologists and other evolutionary biologists.

    2. Reviewer #1 (Public review):

      Domínguez-Rodrigo and colleagues make a moderately convincing case for habitual elephant butchery by Early Pleistocene hominins at Olduvai Gorge (Tanzania), ca. 1.8-1.7 million years ago. They present this at the site scale (the EAK locality, which they excavated), as well as across the penecontemporaneous landscape, analyzing a series of findspots that contain stone tools and large-mammal bones. The latter are primarily elephants, but giraffids and bovids were also butchered in a few localities. The authors claim that this is the earliest well-documented evidence for elephant butchery; doing so requires debunking other purported cases of elephant butchery in the literature, or in one case, reinterpreting elephant bone manipulation as being nutritional (fracturing to obtain marrow) rather than technological (to make bone tools). The authors' critical discussion of these cases may not be consensual, but it surely advances the scientific discourse. The authors conclude by suggesting that an evolutionary threshold was achieved at ca. 1.8 ma, whereby regular elephant consumption rich in fats and perhaps food surplus, more advanced extractive technology (the Acheulian toolkit), and larger human group size had coincided.

      The fieldwork and spatial statistics methods are presented in detail and are solid and helpful, especially the excellent description (all too rare in zooarchaeology papers) of bone conservation and preservation procedures. However, the methods of the zooarchaeological and taphonomic analysis - the core of the study - are peculiarly missing. Some of these are explained along the manuscript, but not in a standard Methods paragraph with suitable references and an explicit account of how the authors recorded bone-surface modifications and the mode of bone fragmentation. This seems more of a technical omission that can be easily fixed than a true shortcoming of the study. The results are detailed and clearly presented.

      By and large, the authors achieved their aims, showcasing recurring elephant butchery in 1.8-1.7 million-year-old archaeological contexts. Nevertheless, some ambiguity surrounds the evolutionary significance part. The authors emphasize the temporal and spatial correlation of (1) elephant butchery, (2) Acheulian toolkits, and (3) larger sites, but do not actually discuss how these elements may be causally related. Is it not possible that larger group size or the adoption of Acheulian technology have nothing to do with megafaunal exploitation? Alternative hypotheses exist, and at least, the authors should try to defend the causation, not just put forward the correlation. The only exception is briefly mentioning food surplus as a "significant advantage", but how exactly, in the absence of food-preservation technologies? Moreover, in a landscape full of aggressive scavengers, such excess carcass parts may become a death trap for hominins, not an advantage. I do think that demonstrating habitual butchery bears very significant implications for human evolution, but more effort should be invested in explaining how this might have worked.

      Overall, this is an interesting manuscript of broad interest that presents original data and interpretations from the Early Pleistocene archaeology of Olduvai Gorge. These observations and the authors' critical review of previously published evidence are an important contribution that will form the basis for building models of Early Pleistocene hominin adaptation.

    3. Reviewer #2 (Public review):

      The authors argue that the Emiliano Aguirre Korongo (EAK) assemblage from the base of Bed II at Olduvai Gorge shows systematic exploitation of elephants by hominins about 1.78 million years ago. They describe it as the earliest clear case of proboscidean butchery at Olduvai and link it to a larger behavioral shift from the Oldowan to the Acheulean.

      The manuscript makes a valuable contribution to the Olduvai Gorge record, offering a detailed description of the EAK faunal assemblage. In particular, the paper provides a high-resolution record of a juvenile Elephas recki carcass, associated lithic artifacts, and several green-broken bone specimens. These data are inherently valuable and will be of significant interest to researchers studying Early Pleistocene taphonomy.

      Comments on previous round of revisions:

      The revised manuscript does a good job of using less definitive language, particularly by adding "possible" qualifiers to several interpretations. This addresses the concern about overstatement.

      The main issue raised in the original review, however, remains unresolved. Only two elephant bone specimens at EAK show green-bone breakage interpreted as anthropogenic, and the diagnostic basis for that interpretation is not demonstrated clearly on the EAK material itself. The manuscript discusses a suite of fracture attributes described as diagnostic of dynamic percussive breakage, but these attributes are not explicitly documented on the EAK specimens. Instead, the diagnostic traits are illustrated using material from other Olduvai contexts, and that behavior is then extrapolated to make similar claims at EAK. For a paper making a potentially important behavioral argument, the key diagnostic evidence is not clearly demonstrated at the focal assemblage.

      This problem is evident in the presentation of the EAK specimens. In their response, the authors state that one EAK specimen shows "overlapping scars" and constitutes a "long bone flake"; however, these features are not clearly identifiable in the figures or captions as currently presented. The authors state that Figures S21-S23 clearly indicate human agency, including a long bone flake with overlapping scars and a view of the medullary surface, but it is unclear which specimens or surfaces these descriptions refer to. Figure S21 does appear to show green fracture and is described only as an "elephant-sized flat bone fragment with green-bone curvilinear break." Figure S22 shows the same bone and cortical surface in a different orientation, providing no additional information. In Figure S23, I cannot clearly identify a medullary surface or evidence of green-bone fracture from this image. None of these images clearly demonstrates overlapping scars, and the figures would be substantially improved by explicitly identifying the features described in the text. Even if both EAK specimens are accepted as green-broken, they do not demonstrate the co-occurrence of multiple diagnostic fracture traits such as multiple green breaks, large step fractures, hackle marks, and overlapping scars that the authors state is required to attribute dynamic percussive activity to hominins and address equifinality.

      I appreciate that the authors are careful to state that spatial association between stone tools and fossils alone does not demonstrate hominin behavior, and that they treat the spatial analyses as supportive rather than decisive. While the association is intriguing, the problem is downstream: spatial association is used to strengthen an interpretation of butchery at EAK that still depends on fracture evidence that is not clearly documented at the assemblage level.

      The critique concerning Nyayanga is not addressed in the revision. The manuscript proposes alternative explanations for the Nyayanga material but does not demonstrate why these are more plausible than the interpretation advanced by Plummer et al. (2023). I am not arguing that the Nyayanga material should be accepted as butchery; rather, showing that trampling is possible does not establish it as more probable than cut marks. In contrast, the EAK material is treated as evidence of butchery on the basis of evidence that, in my opinion, is more limited and less clearly demonstrated. Even if this is not the authors' intention, the uneven treatment removes an earlier megafaunal case from the comparison and strengthens the case for interpreting EAK as marking a behavioral shift toward megafaunal butchery by excluding other early cases.

      While I remain concerned about how the EAK evidence is documented and interpreted, I think the manuscript is appropriate for publication and will generate useful discussion. Readers can then assess for themselves whether the available evidence supports the strength of the behavioral claims.

      [Editors' note: the authors are encouraged to make this version the Version of Record.]

    4. Author response:

      The following is the authors’ response to the previous reviews

      Reviewer #2 (Public review):

      This problem is evident in the presentation of the EAK specimens. In their response, the authors state that one EAK specimen shows "overlapping scars" and constitutes a "long bone flake"; however, these features are not clearly identifiable in the figures or captions as currently presented. The authors state that Figures S21-S23 clearly indicate human agency, including a long bone flake with overlapping scars and a view of the medullary surface, but it is unclear which specimens or surfaces these descriptions refer to. Figure S21 does appear to show green fracture and is described only as an "elephant-sized flat bone fragment with green-bone curvilinear break." Figure S22 shows the same bone and cortical surface in a different orientation, providing no additional information. In Figure S23, I cannot clearly identify a medullary surface or evidence of green-bone fracture from this image. None of these images clearly demonstrates overlapping scars, and the figures would be substantially improved by explicitly identifying the features described in the text. Even if both EAK specimens are accepted as green-broken, they do not demonstrate the co-occurrence of multiple diagnostic fracture traits such as multiple green breaks, large step fractures, hackle marks, and overlapping scars that the authors state is required to attribute dynamic percussive activity to hominins and address equifinality.

      We appreciate the reviewer’s careful evaluation of the EAK specimens. We acknowledge that the overlapping scars and medullary surface of the specimen originally shown in Figure S23 were not sufficiently clear. To address this, we have extensively revised Figure S23. In the updated Supplementary File, we have provided new annotations and line drawings that explicitly trace the outlines of the overlapping scars and clearly shows the green-bone fracture features. These enhancements ensure that the diagnostic traits discussed in the text are now directly identifiable in the visual record. This demonstrates the co-occurrence of traits: green-broken outlines and overlapping scars, which meet the criteria for identifying dynamic percussive activity. This is so following Reviewer´s 2 partial handling of our arguments; since we argued in our previous response that clear simple green-broken elephant long limb bones were an anthropogenic signature per se, given that currently no durophagous predator/scavenger (including spotted hyenas) are able to produce them. Additional secondary features like hackle marks are supportive but not necessary to attribute human agency.

      I appreciate that the authors are careful to state that spatial association between stone tools and fossils alone does not demonstrate hominin behavior, and that they treat the spatial analyses as supportive rather than decisive. While the association is intriguing, the problem is downstream: spatial association is used to strengthen an interpretation of butchery at EAK that still depends on fracture evidence that is not clearly documented at the assemblage level.

      The association is inferred (not demonstrated) by the strong statistical spatial association between lithics and bones. Additional taphonomic evidence (like cut marks or green-broken bones) do further support the inference but they do not demonstrate it, given the highly subjective nature of cut mark identification and the plethora of alternative scenarios: one green-broken bone would not demonstrate complete elephant butchery (it could result from a marginal exploitation of just that bone); one cutmarked bone could equally reflect several alternative access types to the remains. The reviewer recognized above the presence of green-broken elements at EAK; again, this supports anthropogenic agency better than any other alternative scenario, because one of the green-broken bones is a long bone and modern hyenas are not able to produce this kind of specimens.

      The critique concerning Nyayanga is not addressed in the revision. The manuscript proposes alternative explanations for the Nyayanga material but does not demonstrate why these are more plausible than the interpretation advanced by Plummer et al. (2023). I am not arguing that the Nyayanga material should be accepted as butchery; rather, showing that trampling is possible does not establish it as more probable than cut marks. In contrast, the EAK material is treated as evidence of butchery on the basis of evidence that, in my opinion, is more limited and less clearly demonstrated. Even if this is not the authors' intention, the uneven treatment removes an earlier megafaunal case from the comparison and strengthens the case for interpreting EAK as marking a behavioral shift toward megafaunal butchery by excluding other early cases.

      Again, it was never our intention to “demonstrate” anything. The reviewer is misusing this term. These types of arguments are epistemologically impossible to demonstrate. One can just discuss the heuristics of alternative scenarios. The point that we tried to make was that the Nyayanga purported cut marks on megafaunal remains are (as identified and published) impossible to differentiate from natural sedimentary abrasive marks (like trampling). Therefore, they cannot be argued to represent anthropogenic butchery on a secure basis. Especially, when they do not occur in conjunction with green-broken elements of clear dynamic loading nature.

    1. eLife Assessment

      Mitochondrial DNA (mtDNA) exhibits a degree of resistance to mutagenesis under genotoxic stress, and this study on the mitochondrial Transcription Factor A (TFAM) presents important data concerning the possible mechanisms involved. The presented data are solid, technically rigorous, and consistent with established literature findings. The experiments are well-executed, providing convincing evidence on the change of TFAM-DNA interactions following UVC irradiation.

    2. Reviewer #1 (Public review):

      Summary:

      The authors investigate how UVC induced DNA damage alters the interaction between the mitochondrial transcription factor TFAM and mtDNA. Using live-cell imaging, qPCR, atomic force microscopy (AFM), fluorescence anisotropy, and high-throughput DNA-chip assays, they show that UVC irradiation reduces TFAM sequence specificity and increases mtDNA compaction without protecting mtDNA from lesion formation. From these findings the authors suggest that TFAM acts as a "sensor" of damage rather than a protective or repair-promoting factor.

      Strengths:

      (1) The focus on UVC damage offers a clean system to study mtDNA damage sensing independently of more commonly studied repair pathways, such as oxidative DNA damage. The impact of UVC damage is not well understood in the mitochondria and this study fills that gap in knowledge.

      (2) In particular, the custom mitochondrial genome DNA chip provides high resolution mapping of TFAM binding and reveals a global loss of sequence specificity following UVC exposure.

      (3) The combination of in vitro TFAM DNA biophysical approaches combined with cellular responses (gene expression, mtDNA turnover) provides a coherent multi-scale view.

      (4) The authors demonstrate that TFAM induced compaction does not protect mtDNA from UVC lesions, an important contribution given assumptions about TFAM providing protection.

      Weaknesses:

      (1) The authors show a decrease in mtDNA levels and increased lysosomal colocalization but do not define the pathway responsible for degradation. Distinguishing between replication dilution, mitophagy, or targeted degradation would strengthen the interpretation and justifies future experiments.

      (2) The manuscript briefly notes enrichment of TFAM at certain regions of the mitochondrial genome but provides little interpretation of why these regions are favored. Discussion of whether high-occupancy sites correspond to regulatory or structural elements would add valuable context.

      (3) The authors provide a discrepancy between the anisotropy and binding array results. The reason for this is not clear and one wonders if an orthogonal approach for the binding experiments would elucidate this difference (minor point).

      Assessment of conclusions:

      The manuscript successfully meets its primary goal of testing whether TFAM protects mtDNA from UVC damage and the impact this has on the mtDNA. While their data points to an intriguing model that TFAM acts as a sensor of damaged mtDNA, the validation of this model requires further investigation to make the model more convincing. This is likely warranted for a followup study. Also the biological impact of this compaction, such as altering transcription levels is not clear in this study.

      Impact and utility of the methods:

      This work advances our understanding of how mitochondria manage UVC genome damage and proposes a structural mechanism for damage "sensing" independent of canonical repair. The methodology, including the custom TFAM DNA chip, will be broadly useful to the scientific community.

      Context: The study supports a model in which mitochondrial genome integrity is maintained not only by repair factors, but also by selective sequestration or removal of damaged genomes. The demonstration that TFAM compaction correlates with damage rather than protection reframes an interesting role in mtDNA quality control.

      Comments on revised version:

      The authors addressed all concerns during the revision.

    3. Reviewer #2 (Public review):

      Summary:

      King et al. present several sets of experiments aimed to address potential impact of UV irradiation on human mitochondrial DNA as well as possible role of mitochondrial TFAM protein in handling UV irradiated mitochondrial genomes. The carefully worded conclusion derived from the results of experiments performed with human HeLa cells, in vitro small plasmid DNA, with PCR-generated human mitochondrial DNA and with UV-irradiated small oligonucleotides is presented in the title of the manuscript: "UV irradiation alters TFAM binding to mitochondrial DNA". Authors also interpret results of somewhat unconnected experimental approaches to speculate that "TFAM as a potential DNA damage sensing protein in that it promotes UVC-dependent conformational changes in the [mitochondrial] nucleoids, making them more compact. They further propose that such a proposed compaction might trigger removal of UV-damaged mitochondrial genomes as well as facilitates replication of undamaged mitochondrial genomes.

      Strengths:

      (1) Authors presented convincing evidence that a very high dose (1500 J/m2) of UVC applied to oligonucleotides covering the entire mitochondrial DNA genome alleviates sequence specificity of TFAM binding (Figure 3). This high dose was sufficient to cause UV-lesions in a large fraction of individual oligonucleotides. The method has been developed in the lab of one of the corresponding authors (ref. 74) and is technically well refined. This result can be published as is or in combination with other data.

      (2) Manuscript also presents AFM evidence (Figure 4) that TFAM, which was long known to facilitate compaction of mitochondrial genome (Alam et al., 2003; PMID 12626705 and follow up citations), causes in vitro compaction of a small pUC19 plasmid and that approximately 3 UVC lesions per plasmid molecule results in slight albeit detectable increase in TFAM compaction of the plasmid.

      Both results are discussed in line of a possible extrapolation to in vivo phenomena. The revised version of the discussion includes a clear statement that no in vivo support was provided within the set of experiments presented in the manuscript.

      Weaknesses:

      The experiments presented on Figures 3 and 4 may support the speculation that TFAM can carry protective role of eliminating mitochondrial genomes with bulky lesions by way of excessive compaction and removal damaged genomes from the in vivo pool, however extensive additional studies that would go well beyond the experiments described in this paper are needed to fill the gap between this set of results and the proposed explanations.

    4. Reviewer #3 (Public review):

      Summary

      The study is grounded in the observation that mitochondrial DNA (mtDNA) shows some resistance to mutagenesis under genotoxic stress. The manuscript focuses on the effects of UVC-induced DNA damage on TFAM-DNA binding in vitro and in cells. The authors demonstrate increased TFAM-DNA compaction following UVC irradiation in vitro, as assessed by high-throughput protein-DNA binding assays and atomic force microscopy (AFM). The authors did not observe a similar trend in fluorescence polarization assays and attributed the difference in the extent of TFAM oligomerization as a potential reason. In cells, the authors found that UVC exposure increased mRNA levels of TFAM, POLG, and POLRMT without altering mitochondrial membrane potential. Overexpressing TFAM in cells or varying TFAM concentration in reconstituted nucleoids did not alter the accumulation or disappearance of mtDNA damage. Based on their data, the authors proposed a plausible model: following UVC-induced DNA damage, TFAM facilitates nucleoid compaction, which may signal damage in the mitochondrial genome. The proposed model may inspire future follow-up studies to further study the role of TFAM in sensing UVC-induced damage.

      Comments on revised version:

      The authors have addressed the reviewer's concerns.

    5. Author response:

      The following is the authors’ response to the original reviews.

      Public Reviews:

      Reviewer #1 (Public review):

      Summary:

      The authors investigate how UVC-induced DNA damage alters the interaction between the mitochondrial transcription factor TFAM and mtDNA. Using live-cell imaging, qPCR, atomic force microscopy (AFM), fluorescence anisotropy, and high-throughput DNA-chip assays, they show that UVC irradiation reduces TFAM sequence specificity and increases mtDNA compaction without protecting mtDNA from lesion formation. From these findings, the authors suggest that TFAM acts as a "sensor" of damage rather than a protective or repair-promoting factor.

      Strengths:

      (1) The focus on UVC damage offers a clean system to study mtDNA damage sensing independently of more commonly studied repair pathways, such as oxidative DNA damage. The impact of UVC damage is not well understood in the mitochondria, and this study fills that gap in knowledge.

      (2) In particular, the custom mitochondrial genome DNA chip provides high-resolution mapping of TFAM binding and reveals a global loss of sequence specificity following UVC exposure.

      (3) The combination of in vitro TFAM DNA biophysical approaches, combined with cellular responses (gene expression, mtDNA turnover), provides a coherent multi-scale view.

      (4) The authors demonstrate that TFAM-induced compaction does not protect mtDNA from UVC lesions, an important contribution given assumptions about TFAM providing protection.

      Weaknesses:

      (1) The authors show a decrease in mtDNA levels and increased lysosomal colocalization but do not define the pathway responsible for degradation. Distinguishing between replication dilution, mitophagy, or targeted degradation would strengthen the interpretation

      We thank the reviewer for their careful reading of our manuscript and thoughtful suggestions. We agree that distinguishing between replication dilution, mitophagy, and/or targeted degradation would strengthen our understanding of how UV-induced DNA damage is handled in the mitochondria. Currently we are undertaking experiments to tease this apart, but consider the scope of those experiments to be beyond this manuscript and expect to publish them in a subsequent paper rather than this one. We added text explicitly stating that these possibilities are not distinguished by our results in pages 8-9 in the Discussion under the subsection ‘Mitochondria respond to UVC-induced mtDNA damage in the absence of apparent mitochondrial dysfunction’.

      (2) The sudden induction of mtDNA replication genes and transcription at 24 h suggests that intermediate timepoints (e.g., 12 hours) could clarify the kinetics of the response and avoid the impression that the sampling coincidentally captured the peak.

      We agree and have added additional timepoints of 12 hours and 18 hours post exposure. We have updated Figure 2 to include the new data and have added text on page 4 to include these results.

      (3) The authors report no loss of mitochondrial membrane potential, but this single measure is limited. Complementary assays such as Seahorse analysis, ATP quantification, or reactive oxygen species measurement could more fully assess functional integrity.

      We focused on membrane potential because loss of membrane potential is such a well-understood of mechanism for triggering mitophagy, but agree that these additional measurements are useful. We have added experiments to assess ATP levels, but did not see changes; we have added this data to Figure 2. We have also added text highlighting that we previously assessed mtROS following the same levels of UV exposure and observed no changes (in the results section on page 5 and in the discussion section on page 9). Given that we observe no changes in membrane potential or ATP, we have opted to not move forward with Seahorse analysis for the purposes of this paper.

      (4) The manuscript briefly notes enrichment of TFAM at certain regions of the mitochondrial genome but provides little interpretation of why these regions are favored. Discussion of whether high-occupancy sites correspond to regulatory or structural elements would add valuable context.

      We agree a discussion of these findings provides context and insight into where the field is currently in understanding TFAM sequence specificity. We have updated text in the discussion (pages 9-10) to include our thoughts on the drivers of TFAM sequence specificity with regard to the discrepancy with the anisotropy data and the lack of overlap with regulatory/structural elements.

      (5) It remains unclear whether the altered DNA topology promotes TFAM compaction or vice versa. Addressing this directionality, perhaps by including UVC-only controls for plasmid conformation, would help disentangle these effects if UVC is causing compaction alone.

      We have added an additional control making this comparison and updated the text on page 7 in the results section. UVC by itself (without TFAM being present) does not alter the plasmid compaction; see new supplemental Figure S16.

      (6) The authors provide a discrepancy between the anisotropy and binding array results. The reason for this is not clear, and one wonders if an orthogonal approach for the binding experiments would elucidate this difference (minor point).

      The discrepancy between anisotropy and the binding array results is certainly unusual and contrary to previous studies that have used these arrays. In addition to the anisotropy experiments, we selected a ‘high occupancy’ and ‘low occupancy’ sequence from the binding array and performed oligomerization experiments using atomic force microscopy, which allowed us to detect small changes in cooperativity (see supplemental Figure S15). We previously only discussed this briefly in the results section on page 6, but we have now updated the discussion section (pages 9-10) to highlight this finding and put forth ideas for the field as to why we think this might be the case. While we do see that the binding array data aligns with oligomerization and cooperativity of TFAM, we still do not know what it is about these sequences that would drive such differences in TFAM binding, but we speculate that it could have something to do with flexibility of the DNA sequences.

      Assessment of conclusions:

      The manuscript successfully meets its primary goal of testing whether TFAM protects mtDNA from UVC damage and the impact this has on the mtDNA. While their data points to an intriguing model that TFAM acts as a sensor of damaged mtDNA, the validation of this model requires further investigation to make the model more convincing. This is likely warranted for a follow-up study. Also, the biological impact of this compaction, such as altering transcription levels, is not clear in this study.

      We have updated wording in the Abstract, Introduction, and elsewhere in the text (as detailed in other portions of our response) to make as explicit and clear as possible which results are supported by the in vitro versus in vivo data, and which parts are conclusions supported by the data versus hypothesized models to be tested in future work.

      Impact and utility of the methods:

      This work advances our understanding of how mitochondria manage UVC genome damage and proposes a structural mechanism for damage "sensing" independent of canonical repair. The methodology, including the custom TFAM DNA chip, will be broadly useful to the scientific community.

      Context:

      The study supports a model in which mitochondrial genome integrity is maintained not only by repair factors, but also by selective sequestration or removal of damaged genomes. The demonstration that TFAM compaction correlates with damage rather than protection reframes an interesting role in mtDNA quality control.

      Reviewer #2 (Public review):

      Summary:

      King et al. present several sets of experiments aimed to address the potential impact of UV irradiation on human mitochondrial DNA as well as the possible role of mitochondrial TFAM protein in handling UV-irradiated mitochondrial genomes. The carefully worded conclusion derived from the results of experiments performed with human HeLa cells, in vitro small plasmid DNA, with PCR-generated human mitochondrial DNA, and with UV-irradiated small oligonucleotides is presented in the title of the manuscript: "UV irradiation alters TFAM binding to mitochondrial DNA". The authors also interpret results of somewhat unconnected experimental approaches to speculate that "TFAM is a potential DNA damage sensing protein in that it promotes UVC-dependent conformational changes in the [mitochondrial] nucleoids, making them more compact." They further propose that such a proposed compaction triggers the removal of UV-damaged mitochondrial genomes as well as facilitates replication of undamaged mitochondrial genomes.

      Strengths:

      (1) The authors presented convincing evidence that a very high dose (1500 J/m2) of UVC applied to oligonucleotides covering the entire mitochondrial DNA genome alleviates sequence specificity of TFAM binding (Figure 3). This high dose was sufficient to cause UV lesions in a large fraction of individual oligonucleotides. The method was developed in the lab of one of the corresponding authors (reference 74) and is technically well-refined. This result can be published as is or in combination with other data.

      (2) The manuscript also presents AFM evidence (Figure 4) that TFAM, which was long known to facilitate compaction of the mitochondrial genome (Alam et al., 2003; PMID 12626705 and follow-up citations), causes in vitro compaction of a small pUC19 plasmid and that approximately 3 UVC lesions per plasmid molecule result in a slight, albeit detectable, increase in TFAM compaction of the plasmid. Both results can be discussed in line with a possible extrapolation to in vivo phenomena, but such a discussion should include a clear statement that no in vivo support was provided within the set of experiments presented in the manuscript.

      We thank this reviewer for their careful reading and interpretation of the manuscript. We agree that discussion of in vivo implications and extrapolations need clear statements indicating where there is not currently in vivo support. We have updated the text throughout the paper to include this.

      Weaknesses:

      Besides the experiments presented in Figures 3 and 4, other results do not either support or contradict the speculation that TFAM can play a protective role, eliminating mitochondrial genomes with bulky lesions by way of excessive compaction and removing damaged genomes from the in vivo pool.

      To specify these weaknesses:

      (1) Figure 1 - presents evidence that UVC causes a reduction in the number of mitochondrial spots in cells. The role of TFAM is not assessed.

      We are working to understand the role of TFAM in vivo following UV irradiation, but believe that work should be included in follow up studies rather than this publication.

      (2) Figure 2 - presents evidence that UVC causes lesions in mitochondrial genomes in vivo, detectable by qPCR. No direct assessment of TFAM roles in damage repair or mitochondrial DNA turnover is assessed despite the statements in the title of Figure 2 or in associated text. Approximately 2-fold change in gene expression of TFAM and of the three other genes does not provide any reasonable support to suggestion about increased mitochondrial DNA turnover over multiple explanations on related to mitochondrial DNA maintenance.

      We agree and have updated the title of Figure 2 to better reflect the findings outlined in the figure as well as the text.

      The new title is, “UVC causes mtDNA damage that decreases over time and is associated with upregulation of mtDNA replication genes, in the absence of apparent mitochondrial dysfunction.”

      We agree that there are numerous mechanistic hypotheses that could explain the decrease in mtDNA damage over time. In Figure 1, we show that there is an overall decrease in mtDNA spots, and an increase in mtDNA-lysosome colocalization, suggestive of mtDNA degradation, which could serve to remove damaged genomes. One possibility is that TFAM is playing a role in the damage removal (but not repair per cell as these lesions are not repaired). Another is changes in mtDNA turnover via increasing the replication machinery in order the synthesize non-damaged mtDNA molecules to dilute out damage. These and other possibilities are not mutually exclusive. We have added text (pages 8-9) to make explicit that additional work will be required to distinguish these possibilities. We note that we have also added an additional experiment showing that TFAM knockdown affects mtDNA damage at baseline, as well as after UVC exposure (Figure 5J).

      (3) Figure 5. Shows that TFAM does not protect either mitochondrial nucleoids formed in vitro or mitochondrial DNA in vivo from UVC lesions as well as has no effect on in vivo repair of UV lesions.

      We agree that Figure 5 shows that TFAM does not protect DNA from UVC-induced lesions, and that a roughly 2-fold increase in TFAM protein does not alter damage reduction over time. We have added new data showing that in vivo, knockdown of TFAM results in an increase in baseline (control conditions) mtDNA damage, and also alters the rate of decrease of mtDNA damage over time after UVC (Figure 5J).

      (4) Figure 6: Based on the above analysis, the model of the role of TFAM in sensing mtDNA damage and elimination of damaged genomes in vivo appears unsupported.

      We have updated the legend for Figure 6 in which we outline our hypothesized role of TFAM in sensing mtDNA damage to ensure that readers know this has yet to be fully tested in vivo. We have also updated the Figure legend title from “proposed model” to “hypothesized model,” and changed the wording in the conclusion section (page 11) to highlight more clearly that this is a working model.

      (5) Additional concern about Figure 3 and relevant discussion: It is not clear if more uniform TFAM binding to UV irradiated oligonucleotides with varying sequence as compared to non-irradiated oligonucleotides can be explained by just overall reduced binding eliminating sequence specific peaks.

      We do not believe this is the case given the similar K<sub>D</sub> values for the sequences tested. In our hands and in other publications (reviewed in PMID: 34440420), it has been well established that TFAM binds damaged DNA very well—essentially just as well as nondamaged DNA or better.

      Additionally, a reduction in overall binding on these DNA arrays tends to make sequence specific peaks more apparent. We ran our experiments at both 30 nM and 300 nM TFAM specifically to be able to assess this question. The 300 nM data can be found in supplemental Figure S7. In this figure, we notice that the peaks appear more uniform at the high concentration (comparing Figure 3A to Figure S7A). That is presumably because there is so much more binding happening across the array that the peaks associated with the strongest binders become less pronounced. For the sake of brevity, we have not added this reasoning to the text, but are willing to do so if the Reviewers and Editor feel that it is important to include.

      Reviewer #3 (Public review):

      Summary:

      The study is grounded in the observations that mitochondrial DNA (mtDNA) exhibits a degree of resistance to mutagenesis under genotoxic stress. The manuscript focuses on the effects of UVC-induced DNA damage on TFAM-DNA binding in vitro and in cells. The authors demonstrate increased TFAM-DNA compaction following UVC irradiation in vitro based on high-throughput protein-DNA binding and atomic force microscopy (AFM) experiments. They did not observe a similar trend in fluorescence polarization assays. In cells, the authors found that UVC exposure upregulated TFAM, POLG, and POLRMT mRNA levels without affecting the mitochondrial membrane potential. Overexpressing TFAM in cells or varying TFAM concentration in reconstituted nucleoids did not alter the accumulation or disappearance of mtDNA damage. Based on their data, the authors proposed a plausible model that, following UVC-induced DNA damage, TFAM facilitates nucleoid compaction, which may serve to signal damage in the mitochondrial genome.

      Strengths:

      The presented data are solid, technically rigorous, and consistent with established literature findings. The experiments are well-executed, providing reliable evidence on the change of TFAM-DNA interactions following UVC irradiation. The proposed model may inspire future follow-up studies to further study the role of TFAM in sensing UVC-induced damage.

      Weaknesses:

      The manuscript could be further improved by refining specific interpretations and ensuring terminology aligns precisely with the data presented.

      (1) In line 322, the claim of increased "nucleoid compaction" in cells should be removed, as there is a lack of direct cellular evidence. Given that non-DNA-bound TFAM is subject to protease digestion, it is uncertain to what extent the overexpressed TFAM actually integrates into and compacts mitochondrial nucleoids in the absence of supporting immunofluorescence data.

      We would like to thank this reviewer for their comments and suggestions. We feel these specific language changes have strengthened the interpretability of the text. The TFAM overexpression cells used in this experiment were given to us by Isaac et al., who demonstrated that when TFAM was overexpressed in this specific cell line, the nucleoids were indeed more compact, measured by Fiber-seq (Isaac et al., 2024; PMID: 38347148). We have removed the claim “increased compaction” from the section title, Figure 5 legend title, and from line 322 (now on page 8), and have also added an additional sentence to ensure the reader knows these cells have been shown to have presumed increased compaction by other groups.

      (2) In lines 405 and 406, the authors should avoid equating TFAM overexpression with compaction in the cellular context unless the compaction is directly visualized or measured.

      We have updated the text to ensure that it is clear that this was tested by other groups. We also changed the wording to “inaccessible (presumably compacted) nucleoids.” While we did not demonstrate altered compaction in our study, we think that based on the results from Isaac et al., it is likely that there was increased compaction. In addition, some readers might not have the context to make the connection between compaction and accessibility, so eliminating all reference to compaction could obscure the point.

      (3) In lines 304 and 305 (and several other places throughout the manuscript), the authors use the term "removal rates". A "removal rate" requires a direct comparison of accumulated lesion levels over a time course under different conditions. Given the complexity of UV-induced DNA damage-which involves both damage formation and potential removal via multiple pathways-a more accurate term that reflects the net result of these opposing processes is "accumulated DNA damage levels." This terminology better reflects the final state measured and avoids implying a single, active 'removal' pathway without sufficient kinetic data.

      We agree and have updated the language throughout the text as well as the results heading for this section.

      (4) In line 357, the authors refer to the decrease in the total DNA damage level as "The removal of damaged mtDNA". The decrease may be simply due to the turnover and resynthesis of non-damaged mtDNA molecules. The term "removal" may mislead the casual reader into interpreting the effect as an active repair/removal process.

      We agree and have restructured this sentence for clarity. We do believe there is some removal happening, given the increase in mtDNA colocalization in lysosomes alongside decrease of mtDNA spots in our live cell imaging. We have written it to reflect the inclusion of removal and resynthesis of nondamaged mtDNA molecules (see pages 8-9).

      Recommendations for the authors:

      Reviewing Editor Comments:

      The reviewers appreciate the quality of the presented data but concur that they do not support the primary claims in the title and abstract. The reviewers also realize that in vivo evidence for the model would require extensive new experimentation that goes beyond a reasonable revision. The recommendation is to change the title and significantly revise text, figure titles and legends for transparency, and conclusions within results and discussion sections.

      We thank the editor and all the reviewers for their feedback. We have added additional experiments, updated text throughout the entire paper to ensure our claims are supported, and revised our title. We feel that the changes we have made have indeed made the paper stronger, more transparent, and that the evidence put forth in this paper provides support for all claims made.

      Reviewer #1 (Recommendations for the authors):

      (1) Clarify mitochondrial response kinetics by adding an intermediate (e.g., 12 hrs) recovery timepoint for transcriptional analysis to resolve when TFAM and replication genes are induced.

      We have added additional timepoints of 12 and 18 hours following exposure in Figure 2. These results strengthen our finding that the nuclear transcriptional program supporting mtDNA replication appears to be activated prior to the nuclear transcriptional program supporting mitochondrial transcription, in that POLG and TFAM come up before POLRMT and ND1.

      (2) Strengthen functional readouts by assessing additional parameters of mitochondrial function to substantiate the claim that UVC does not impair mitochondrial performance.

      We have referenced our previously-published data on mtROS and added a measurement of ATP following UVC exposure in Figure 2.

      (3) Consider exploring whether mtDNA degradation occurs via mitophagy, nucleoid-phagy, or another pathway-potentially by using inhibitors or markers of these processes.

      While we agree that this is an important follow up question and are currently working on experiments to address this, those experiments are outside the scope of this manuscript.

      (4) Provide additional details for the high occupancy TFAM sites. Provide brief annotation or discussion of genomic regions showing strong TFAM binding under non-irradiated conditions that are lost during UVC treatment. This would be helpful to the field as a whole.

      We have updated our discussion section to include this.

      (5) Include or discuss a control using UVC irradiated pUC19 without TFAM to confirm that observed compaction categories are TFAM dependent rather than an UVC induced DNA distortion.

      We have added in a supplemental figure (Figure S16) containing comparison of area analysis of control pUC19 and UV-irradiated pUC19 and we have added associated text in the results section of the paper.

      (6) It would be interesting to explore the link between compaction to transcriptional output. In the TFAM overexpression model, the authors could measure expression of mtDNA encoded transcripts (e.g., ND1, COX1) to connect increased compaction with altered mitochondrial transcription.

      While we agree that understanding how the compactional status alters mitochondrial transcription is worthwhile, we believe this is beyond the scope of this paper. Furthermore, this connection has previously been shown by Bruser et al., 2021 (PMID: 34818548) who showed that more compact nucleoids are not undergoing active transcription. It will be interesting to see in future work if mtDNA damage drives changes in both compaction as well as transcriptional activity.

      (7) Clarify quantitative presentation in figure 2F to explicitly note whether the observed increase in fluorescence intensity was statistically insignificant and confirm that the assay sensitivity is sufficient to detect small potential changes. As presented it is not clear if there is a change.

      We have changed the presentation of Figure 2F. There is a slight increase in membrane potential at the 24-hour time point and we have made that clear in the text as well. We included FCCP as a (standard) positive control, for which we can detect the associated decrease in membrane potential for. While it is always possible that a very small decrease occurred that we were unable to detect, we note that none of the six UVC-exposed groups that we tested even trended towards a decrease in MMP, making it less likely that there was an effect that we simply lacked the power or sensitivity to detect.

      (8) It would be interesting if the authors can comment on whether TFAM induced compaction after UVC might shield mtDNA from other, repairable lesions (e.g., oxidative or alkylation damage), offering a broader context for this mechanism beyond just UVC.

      In theory, we believe this is possible. It will also be interesting to see if the increased compaction following UVC also protects or shields the mtDNA from other enzymatic processes, such as repair proteins that may be searching for repairable lesions such as oxidative or alkylation damage. In this case, it seems as though the increased compaction would prevent the repair from happening at genomes harboring damage.

      In this study we show with our in vitro nucleoids that the increased compaction does not protect against UVC, but this is likely because UVC does not need physical access to the DNA in order to damage it, as the wavelengths of UVC (centered in this case at 254nm) are readily absorbed by proteins and thus can go right through the proteins. Currently, we know that increased compaction by TFAM makes the DNA inaccessible to the enzymes required to methylate DNA used in Fiber-seq (PMID: 38347148), but we do not know if the compaction is tight enough to prevent ROS or alkylating agents from damaging the DNA. We have updated text in the discussion on page 10 to highlight some of these ideas.

      Reviewer #2 (Recommendations for the authors):

      Please, go over all display items and text and clarify details that can help readers to understand important specifics of the experiments. Examples are provided below:

      (1) Abstract and Introduction - indicate species and cell line

      We have updated the text to include this information.

      (2) Table 1 "TFAM KD measurements"- title and footnotes are entirely cryptic. Please, clarify the experimental design, question(s) addressed and conclusions drawn from data.

      We have updated the title of Table 1 to "Binding of TFAM to array sequences, measured using fluorescence anisotropy,” and clarified the footnotes to make sure it is clear which sequences were selected for AFM oligomerization experiments.

      (3) Figure 3 and Material and Methods - specify UVC dose.

      We have added this information to both the figure legend and the methods section.

      (4) Figure 4 - specify UVC dose.

      We have added this information to the figure legend.

      (5) Figure 5. Panel B indicate which band is TFAM and which is HA-tag; Indicate clearly which panel is showing in vivo or in vitro results.

      We have updated the figure to label the untagged TFAM and HA-tagged TFAM and changed the panel titles to specify if they are in vivo results.

    1. eLife Assessment

      This valuable study provides convincing evidence that MgdE, a conserved mycobacterial nucleomodulin, downregulates inflammatory gene transcription by interacting with the histone methyltransferase COMPASS complex and altering histone H3 lysine methylation. This work will interest microbiologists as well as cell and cancer biologists.

    2. Reviewer #1 (Public review):

      Summary:

      This fundamental study identifies a new mechanism that involves a mycobacterial nucleomodulin manipulation of the host histone methyltransferase COMPASS complex to promote infection. Although other intracellular pathogens are known to manipulate histone methylation, this is the first report demonstrating specific targeting the COMPASS complex by a pathogen. The rigorous experimental design using of state-of-the art bioinformatic analysis, protein modeling, molecular and cellular interaction and functional approaches, culminating with in vivo infection modeling provide convincing, unequivocal evidence that supports the authors claims. This work will be of particular interest to cellular microbiologist working on microbial virulence mechanisms and effectors, specifically nucleomodulins, and cell/cancer biologists that examine COMPASS dysfunction in cancer biology.

      Strengths:

      (1) The strengths of this study include the rigorous and comprehensive experimental design that involved numerous state-of-the-art approaches to identify potential nucleomodulins, define molecular nucleomodulin-host interactions, cellular nucleomodulin localization, intracellular survival, and inflammatory gene transcriptional responses, and confirmation of the inflammatory and infection phenotype in a small animal model.

      (2) The use of bioinformatic, cellular and in vivo modeling that are consistent and support the overall conclusions is a strengthen of the study. In addition, the rigorous experimental design and data analysis including the supplemental data provided, further strengthens the evidence supporting the conclusions.

      Comments on revisions:

      The authors have previously addressed the weaknesses that were identified by this reviewer by providing rational explanation and specific references that support the findings and conclusions.

    3. Reviewer #2 (Public review):

      Summary:

      The manuscript by Chen et al addresses an important aspect of pathogenesis for mycobacterial pathogens, seeking to understand how bacterial effector proteins disrupt the host immune response. To address this question the authors sought to identify bacterial effectors from M. tuberculosis (Mtb) that localize to the host nucleus and disrupt host gene expression as a means of impairing host immune function. Their revised manuscript has strengthened their observations by performing additional experiments with BCG strains expressing tagged MgdE.

      Strengths:

      The researchers conducted a rigorous bioinformatic analysis to identify secreted effectors containing mammalian nuclear localization signal (NLS) sequences, which formed the basis of quantitative microscopy analysis to identify bacterial proteins that had nuclear targeting within human cells. The study used two complementary methods to detect protein-protein interaction: yeast two-hybrid assays and reciprocal immunoprecipitation (IP). The combined use of these techniques provides strong evidence of interactions between MgdE and SET1 components and suggests the interactions are in fact direct. The authors also carried out rigorous analysis of changes in gene expression in macrophages infected with MgdE mutant BCG. They found strong and consistent effects on key cytokines such as IL6 and CSF1/2, suggesting that nuclear-localized MgdE does in fact alter gene expression during infection of macrophages. The revised manuscript contains additional biochemical analyses of BCG strains expressing tagged MgdE that further supports their microscopy findings.

    4. Reviewer #3 (Public review):

      In this study, Chen L et al. systematically analyzed the mycobacterial nucleomodulins and identified MgdE as a key nucleomodulin in pathogenesis. They found that MgdE enters into host cell nucleus through two nuclear localization signals, KRIR108-111 and RLRRPR300-305, and then interacts with COMPASS complex subunits ASH2L and WDR5 to suppress H3K4 methylation-mediated transcription of pro-inflammatory cytokines, thereby promoting mycobacterial survival.

      Comments on revisions:

      The authors have previously adequately addressed previous concerns through additional experimentation. The revised data robustly support the main conclusions, demonstrating that MgdE engages the host COMPASS complex to suppress H3K4 methylation, thereby repressing pro-inflammatory gene expression and promoting mycobacterial survival. This work represents a significant conceptual advance.