1. Last 7 days
    1. On 2022-08-18 12:02:23, user Pieter Bots wrote:

      First of all, I welcome such a thorough investigation of new initiatives. I hope this will be done more in the future with other initiatives as well. Though, I personally do have several queries with respect to the SciCV effectiveness and this preprint.

      With respect to the academic age, in addition to the time take off for parental leave etc. another omission in the manuscript is that in some labs / countries it's common to not publish during their PhD and some labs / countries where it's mandatory to publish to pass their viva which is not taken into account in the academic age. In addition to this, the academic age does not take into account that some students might publish during their BSc or MSc or are included as co-authors on papers during their BSc or MSc. All of these affects the academic age metric without affecting the applicants ability or suitability to be awarded funding. The academic age also does not take into account any time spent in institutions where bullying and harassment has occurred affecting someone's productivity and I would argue this could effectively decrease someone's academic age. In addition the academic age metric could be misused by students and delaying their PhD publications to the last year of their PhD to decrease their academic age and make it come across as if they've got more potential compared to PhD students who didn't do this or weren't advised to do so. So to me the academic age just appears to be another metric that does not (accurately) reflect the applicants capabilities or even career stage.

      One of my main concerns with respect to the narrative CV and another query with respect to the preprint is related to the section in 'Interviews' on the narratives. <br /> (1) "The interviews indicate that applicants disliked the amount of time needed to author narratives". Based on my own personal experience (the narrative CV for an EPSRC grant caused major anxiety and was the single task that prevented me from submitting the grant proposal) I suspect that potential applicants with anxiety, caring responsibility, dyslexia, etc. will struggle a lot more with completing this task and as it did in my case prevent them from submitting their grant proposal. So did the authors attempt to investigate this, what is the authors opinion on this? Would including people that were not able to submit grant applications in the interviews and survey change the conclusion that the "SciCV was a relevant and successful initiative"?<br /> (2) "redundancy and the use of boastful language in narratives were also criticised by some reviewers." To me this comes across as if the narrative CV will benefit those most with the best support or understanding how to 'play the system': the politicians, not the applicants with most potential to complete a research project successfully.

      Finally, my last query about the preprint is related to the final paragraph in the discussion: "Not surprisingly, SciCV alone had only a limited effect on the adherence to DORA-conformity during evaluation. ... Other funding organisations experimenting with new, text-based CV format such as the Science Foundation Ireland report similar findings [10], highlighting the need for additional accompanying measures such as clear guidelines or training." With (such) a limited effectiveness of the SciCV/narrative CV, I am curious how the authors come to the conclusion that the "SciCV was a relevant and successful initiative". Also, is it worth requiring applicants to put in significantly more effort creating such document for the submission for grant applications with limited effectiveness, and when even then still additional measures are needed for the process to be fair? The authors suggest such measures to be clear guidance and training, which, frankly, assessors and reviewers could easily ignore and let their personal (implicit or explicit) biases guide their assessment or review. So to me, the narrative CV, albeit well intended (and before trying to write one myself I thought this was/could be an amazing intervention) comes across as trying to make life of the reviewers and assessors more easy while creating significantly more work for the applicants, potentially preventing them from even submitting a grant application. Has the narrative CV/SciCV been compared to other interventions that create less work for the applicant and force reviewers/assessors to adhere to DORA and remove any chance for biases to guide assessments/reviews, such as double blind review (e.g.: https://smallpondscience.co...

      Best wishes,

      Pieter

    1. On 2022-08-17 15:39:08, user Martin R. Smith wrote:

      Congratulations on a very careful and detailed study. You might be interested to further explore the distribution of trees in tree space mappings using distances other than the Robinson-Foulds, which is known to mis-represent spatial relationships within trees: see Smith 2022a, Syst. Biol, https://doi.org/10.1093/sys... . It might also be possible to reconcile some of the discordance by removing rogue taxa -- see Smith 2022b, Syst. Biol, https://doi.org/10.1093/sys... / R package "Rogue".

    1. On 2022-08-17 11:37:05, user Iratxe Puebla wrote:

      Review coordinated via ASAPbio’s crowd preprint review

      This review reflects comments and contributions by Ruchika Bajaj, Pablo Ranea-Robles and Michael Robichaux. Review synthesized by Michael Robichaux.

      The manuscript reports findings from new knockout human cell lines for the mitochondrial release factors mtRF1 and mtRF1a. The work contributes new insight into mitochondrial protein translation and mechanisms related to mitochondrial disease. A specific role is demonstrated for the release factor mtRF1 in the translation of COX1, a mitochondrial respiratory protein. The manuscript also identified a compensatory role for the mitochondrial ribosome-associated quality control (mtRQC) pathway when mitochondrial translation termination is impaired.

      Overall the experiments and results presented in the manuscript are supportive of the conclusions described in the text. These findings are impactful toward understanding mitochondrial translation termination.

      Major comments

      In the results section related to Figure 1d, an increase in reactive oxygen species (ROS) is measured using the mitoSOX probe. Considering that mitoSOX measures superoxide accumulation in the mitochondria, please consider specifying in the text that the ROS measured is of mitochondrial origin. In addition, since mitoSOX labeling may be affected by changes in mitochondrial membrane potential or mitochondrial shape and size, please consider adding an experimental condition using a membrane-potential-responsive, redox-insensitive probe. Finally, please clarify the results presented in Figure 1d with more technical detail. What do the n-values signify? Technically, how is ROS production measured?

      For Figure 2b-d, in gel activity for complex I and IV are measured; please provide further technical details for these experiments. Please describe what kind of activity is being measured and how it is measured. Also consider adding a density graph of these gel data for clarification of the results.

      Referencing Figure 2b-c, specifically, it is stated in the Results section that “mtRF1 loss does not affect complex I..”; however, the figure shows an increase in activity of ~20% for the mtRF1-/- condition. Please consider rephrasing or clarifying this point.

      For Figure 3, there is a possible discrepancy in these results that may need to be addressed. For example, the difference of the relative intensity of ND6 between the WT vs. mtRF1a-/- conditions shown in Fig 3a is significantly less than what is quantified for the same comparison in the bar graph in Fig 3e. It is possible these analyses were performed differently; if so, please report this.

      Minor comments

      It is stated in the first Results section: “In the absence of mtRF1a, cells tend to produce more reactive oxygen species (ROS)...”, which is vague, please rewrite more technically since it is describing the quantitative data in Fig 1D. From this same section, the final statement: “Thus, both release factors are critical for mitochondrial function and cellular growth” is perhaps too conclusive based only on the results from Figure 1.

      Related to Fig 1c: consider converting the graph to a log scale, which may help illustrate the difference in growth rates between conditions. In addition to measuring cellular growth, please also consider measuring/counting mitochondria and examining cell morphology changes, which may be easy, additive experiments to include here.

      In the Results section related to Fig. 2a-d, the respiratory chain complexes are presented with no context. Consider mentioning these complexes in the Introduction or contextualizing them better in this section.

      In this same Results section please add appropriate citations for “Figure 2g” when referencing results related to that figure panel.

      A portion of the results text related to Figure 4a-b states: “With the exception of MTND6 (mRNA encoding for ND6), all of the mt-mRNAs arise from the polycistronic transcript synthesized from the heavy strand. If the loss of mitochondrial RFs would affect mitochondrial transcription, one would expect an overall decrease in all mitochondrial transcripts. However, as we observe a selective decrease in specific transcripts in the individual knockouts, we conclude that it is more likely an issue of RNA stability rather than synthesis.” This may be more appropriate to include in the Discussion section.

      In the Results section related to Figure 5, please again consider properly citing the figures when describing the results presented in those figures and panels.

      While Figure 6 is an informative model figure, please consider explaining the model with respect to results in the manuscript.

      Comments on reporting

      Please consider adding more detail in the Methods section about the statistical analyses performed in this study. In addition, other statistical tests may be needed for some group comparisons (e.g., two-way ANOVA for the data in Fig. 5d).

      For all the western blot data presented in the manuscript, please consider adding the full blot scans to the supplemental material.

      Referencing Supplementary Table S1, please consider adding validation references for the antibodies used in this study. This is of great benefit to other researchers.

      Suggestions for future studies

      Future studies may test the effect of the combined ablation of the mtRF1 and mtRF1a release factors.

    1. On 2022-08-16 05:38:19, user Martin R. Smith wrote:

      A small note on the RF distance: this doesn't count "the number of operations required to convert one tree into another" (that would be an edit distance such as SPR / TBR), but the number of splits in one tree but not another. It also has a number of shortcomings (see Smith 2020, https://doi.org/10.1093/bio... ) – potentially a more resilient metric would produce a more consistent signal, and paint a more complete picture, in your table 6?

    1. On 2022-08-16 05:21:15, user Martin R. Smith wrote:

      Very interesting to see the early origin of these important proteins. For what it's worth, you might be able to squeeze yet more resolution out of your Rogue taxon analysis using the information theoretic approach implemented in the R package "Rogue"; see Smith 2022, Syst Biol, https://doi.org/10.1093/sys...

    1. On 2022-08-15 11:25:40, user Biró Bálint wrote:

      Dear All,

      Thank you very much for your comments. As you have correctly pointed out some of the references have been mixed up. This has been corrected and we uploaded a new version of our manuscript which would be available hopefully very soon.

      Best regards,<br /> Authors

    2. On 2022-08-13 17:57:32, user Rajender Singh wrote:

      Dear Authors, <br /> Lopez et al. is not the right reference as you have stated in your manuscript in the line 'The sequences in the nuclear genome with mitochondrial origins are called numts and their integration process itself is called numtogenesis (Lopez et al., 1994).'

      You should replace this with other suitable references, which I am mentioning here;

      Migration of mitochondrial DNA in the nuclear genome of colorectal adenocarcinoma. PMID: 28356157

      Single molecule mtDNA fiber FISH for analyzing numtogenesis. PMID: 28322800

      Numtogenesis as a mechanism for development of cancer. PMID: 28511886

      I hope you will take a note of my comment.

      Thanks.

      Dr. Rajender Singh<br /> Senior Principal Scientist and Professor

    3. On 2022-08-13 03:45:59, user Keshav Singh wrote:

      Please note the term numtogenesis was coined by Singh et al 2017 and not by Lopez et al 1994.<br /> Thanks <br /> Keshav Singh

    1. On 2022-08-15 09:45:59, user Richard Zimmermann wrote:

      Congratulations to all authors for both making this heroic effort and this brilliant manuscript, which will undoubtedly further advance the already ongoing attempts to develop Sec61 channel inhibitors into therapeutics in human medicine (reference 28). Interestingly, the manuscript reports that two of the inhibitors (Eeyarestatin 1 and Mycolactone) are different from the other tested inhibitors in "further penetrating the cytosolic funnel of Sec61". Notably, Eeyarestatin 1 as well as Mycolactone were previously shown to enhance Sec61-mediated Ca2+ leakage from the ER in human cells, which can lead to apoptosis and, therefore, appears as medically relevant. In my opinion, it´s a pity that this aspect was not discussed in the manuscript.

    1. On 2022-08-15 09:25:19, user Iratxe Puebla wrote:

      Review coordinated via ASAPbio’s crowd preprint review

      This review reflects comments and contributions by Ashley Albright, Samuel Lord, Arthur Molines and Sónia Gomes Pereira. Review synthesized by Iratxe Puebla.

      The paper studies the involvement of aneuploidy in promoting chromosomal instability and suggests the aneuploid state of cancer cells as a point-mutation independent source of genome instability. The paper reports a considerable amount of data. We outline below some suggestions regarding presentation and the analyses reported:

      mis-segregation in otherwise pseudo-diploid human cells’ - Please provide some explanation for the term ‘pseudo-diploid’.

      suggesting that dormant replication origins’ - Please provide a sentence clarifying the meaning of ‘dormant replication’.

      ‘Cells activate dormant origins in response to reduced fork rate and stalled forks to ensure that the genome gets fully replicated in time’ - Please provide a reference to support this statement.

      Figure 3

      Recommend re-arranging the order and position of the panels for greater clarity.

      Interestingly, we found a positive correlation between S phase length and frequency of abnormal mitoses (mean S phase length in control: 603,3 ± 55,4; aneuploid: 728,7 ± 46,2) (Fig. 3c).’ - Figure 3C shows that the cells that have an abnormal mitosis had a slightly longer S phase on average, however there is no correlation analysis done or an analysis around "frequency of abnormal mitosis", recommend revising the sentence.

      Figure 3C - Cells with a longer S phase (or cell cycle in general) will receive more light before reaching mitosis. Is it possible that the correlation mentioned is due to photo-toxicity? Longer S phase -> more photo-toxicity -> abnormal mitosis. Recommend adding a control to account for the potential phototoxicity of the imaging.

      Figure 4 - Panels C and D show that, among the cells that have foci, the number of foci is increased, either by aneuploidy or by the drugs. However, it is unclear from the data if the number of cells with foci also increases. Would it be possible to plot the % of cells with more than 1 foci for each condition? (as in Figure 4G). Also, C and D are aggregates of multiple experiments, it would be good to show the data per replicates.

      ‘there was a sub-population of senescent cells in the aneuploid sample (Fig. 5a)’ - Was senescence tested in the normal (euploid) population too (at the same passage)? Is that the sample named as "control" in the figure legend?

      in aneuploid cycling cells was comparable to that of the controls for at least 3 generations by live-cell imaging (Fig. 6a-c)’ - Suggest clarifying here what the control is, in addition to naming it in the figure legend.

      Comments on analyses/reporting

      In various figures (including Figures 1H,J,L,N,O; 2C,G,E; 3I; 4C,D; 5H,I; 6H,I,J), there is a concern about the statistical approach to calculate p-values based on multiple measurements or cells within each sample. The t-test assumes that each measurement is independent, and multiple cells within the same sample are not independent. Recommend either not reporting p-values or averaging together the values from each sample and calculating the p-value using those sample-level means. For more information, see https://doi.org/10.1371/jou... and https://doi.org/10.1083/jcb...

      For each bar graph throughout the paper, recommend reporting the value of n, in the figure itself, the figure legend, or in the text. Using Figure 1C as an example, this reports a doubling in the number of cells with greater than 10 errors, but the significance of that would vary depending on the number of cells analyzed. Some plots in panels c and f have no error bars, and it would be useful to report the number of experiments.

      Almost every figure features representative images. The manuscript includes a massive amount of data already, but it may be relevant to show additional images in the supplement in cases where representative images are used in figures.

      Data analysis for RNAseq ‘results were filtered only based on p-value’ - Please clarify why the False Discovery Rate was not taken into the filtering step.

    1. On 2022-08-15 09:10:34, user Iratxe Puebla wrote:

      Review coordinated via ASAPbio’s crowd preprint review

      This review reflects comments and contributions by Luciana Gallo, Lauren Gonzalez, Claudia Molina, Arthur Molines, Srimeenakshi Sankaranarayanan and Sanjeev Sharma. Review synthesized by Iratxe Puebla.

      The manuscript studies the role of the long-coding RNA lncRNA H19 in cellular senescence. The results show that H19 levels decline as cells undergo senescence and repression of H19 is triggered by the loss of CTCF and prolonged activation of p53. The loss of H19 leads to increased let7b-mediated targeting of EZH2. The mTOR inhibitor rapamycin maintains lncRNA H19 levels throughout the cellular lifespan preventing reduction of EZH2 and cellular senescence.

      The reviewers found the methodology appropriate but raised some comments and suggestions about the paper as outlined below:

      Introduction ‘H19 is a highly conserved, maternally expressed imprinted gene and encodes a 2.3 kb long non-coding RNA (lncRNA). It is located immediately downstream of the neighboring gene IGF2.’ - An additional reference to the expression pattern/levels of lncRNA H19 across 'normal' tissues/developmental stages would be useful to provide immediate insight into the contexts where H19 is important and note the conditions where its levels are altered.

      To characterize the role of H19 in the cellular senescence of somatic cells, we examined H19 expression during replicative senescence of human cardiac fibroblasts’ - The data on changes in expression of H19 with age/culture time is very interesting. Suggest providing some comments on the choice of experimental systems for each experiment and why HCF cells were used to study replicative senescence while other experiments were completed in skin samples.

      Figure 1

      Figure 1a - Please indicate in the legend how far apart or what are the passage numbers for 'early' and 'late' passages for the cell culture experiments. Is the reduction in H19 gradual or does it sharply decrease after a certain number of passages? What biological meaning would either of these observations have and how does it relate to mouse data in vivo?

      Supplementary Figure 1 shows a sharp drop between PD 20 and PD 50. Would it be possible to provide a finer analysis of H19 levels across many cell passages?

      Figure 1b - Recommend using the same normalization in a) and b). In a) levels are normalized to the first condition "early" while in b) levels are normalized to the second condition "old".

      Figures 1d and g - Please provide further information on how Cumulative population doublings were measured and clarification for the numbers on the Y axis.

      decreased the lifespan of cells (Figure 1d; Figure 1-figure supplement 1c)’ - Figure 1d measures cells' doubling time, not lifespan. If lifespan is being inferred from doubling time, please provide some clarification on how this is being done. There are fewer cells after 15 days but it does not mean that cells are dying, it could be that they are growing slower. Please also provide details for the methodology followed to obtain the data in this panel.

      Figure 2

      CTCF mRNA and protein levels decreased in the late passage cells (Figure 2a and b), and CTCF knockdown in early passage cells induced premature senescence characterized by increased SA-β-gal staining and reduction in proliferation (Figure 2-figure supplement 2a). In contrast, treatment with rapamycin mitigated CTCF depletion, which is consistent with the effect of rapamycin maintaining H19 levels (Figure 2a and b). Furthermore, the regulatory link between CTCF and H19 is supported by decreased H19 expression in CTCF-targeted cells (Figure 2c).’ - CTCF knockdown and rapamycin treatment can affect many pathways, recommend toning down this conclusion. In Supplemental Figure 2a, the % of positive cells in the siNeg condition is significantly higher than in Figure 1e (close to 50% in Sup Fig 2a vs 30 % in Fig 1e). Recommend providing some comments on the variability of the control value as that level of variability can confound the conclusions. For example, the siCTCF condition is lower than the siNeg control condition when compared with the value from Sup Fig 2a but not when compared with the value from Fig 1e.

      Figure 2d - Remove "presentation last saved just now" from the panel.

      a stress-dependent downregulation of CTCF through proteasomal degradation of CTCF protein in endothelial cells (51)’ - The paper cited here discusses epithelial cells, should the reference to endothelial cells be updated?

      Figure 3 - Please provide further clarification regarding acute stress or prolonged activation of p53. What are the timescales? How do these relate to replicative senescence seen with aging or as cells at late passages?

      Together these results confirm that activation of p53 is responsible for the downregulation of H19 as part of DNA damage response’ - Please provide further clarification regarding the reference to DNA damage. Is this an inference from the statement about "activation of p53 is crucial for establishing senescence as part of DDR"? p53, like CTCF and mTOR, can play different roles.

      Given the mounting evidence suggesting the role of lncRNA H19 as a competing endogenous RNA (ceRNA) or miRNA sponge (60–62), we speculated that H19 might mediate the senescence program by regulating miRNA availability. To determine which miRNAs are directly regulated by lncRNA H19 during senescence, we evaluated miRNA expression profiles in control and H19 targeted cells (Figure 4a).’ - Can some further clarification be provided for this claim, if H19 is acting as a miRNA sponge, it wouldn't affect its overall levels, but rather its ability to bind its target genest? Based on the data presented, the link between let7b and H19 appears to be more related to let7b expression than sequestration. Consider removing the fragment or revising it to clarify the mechanistic link drawn between H19 and let7b. To show that H19 is acting as a sponge in this system, it may be necessary to mutate the complementary sequence and check whether let7b's activity increases (i.e. its target genes are down-regulated).

      Among the top miRNAs upregulated in H19 depleted cells were members of the let7 family; specifically, let7b expression was significantly upregulated (Figure 4b’ - Suggest adding some more information about the other miRNAs that are affected.

      Figure 4f ‘Senescence-associated secretory’ - Please clarify why SERPINE mRNA level is considered instead of IL-6 as in Figure 1f.

      suggests the loss of EH2 results in a general decrease in PRC2 activity’ - should EH2 read EZH2?

      Figure 5 - What happens to CDKN2A levels when H19 is depleted or overexpressed? Can the H3Kme3 antibody binding data be supported with expression data for CDKN2A? It may be relevant to see whether it follows the expectation that loss of H19 reduces EZH2 expression and increases p16 expression.

      Figure 6 - Please provide some brief clarification for what the solid and dashed lines represent in the model.

      More importantly, prolonged treatment with mTOR inhibitor rapamycin maintains lncRNA H19 levels by preventing the loss of CTCF expression and activation of p53, thus preventing the induction of senescence.’ - There is a question as to whether the experiments presented support this statement, suggest reframing the fragment. The strongest mechanistic experiments in the study are those regarding let7b, because they use the mimic to "rescue" its function.

      Supplementary Figure 1d - It is nice to see authors tested 2 different siRNAs for H19 and these showed the same effect in Panel d. Can some discussion be provided for why overexpression of H19 leads to an increase in senescence markers and reduced proliferation.The outcomes of siRNA experiments may not sufficiently support the correlation between H19 levels and senescence induction. This is an example where both excess H19 and reduced levels of H19 have the same effect and it is a very important result. Would it be possible to titrate the expression of H19 to achieve different levels of overexpression and then analyze senescence markers under these conditions? It may also be possible to generate a siRNA-resistant overexpression construct to rescue the effects seen with siRNA-mediated depletion of H19.

      Supplementary Figure 5 - Recommend updating the presentation to more clearly highlight the decrease in binding as mentioned in the main text.

      Methods

      10g of plasmid DNA was transfected’ - should this read 10 micrograms?

      ΔΔCT method’ - Please clarify the control for calculating relative mRNA levels.

      Cells were incubated with EdU stain (100mM Tris (pH8.5), 1mM CuSO4, 1.25 μM Azide Fluor 488, and 50mM ascorbic acid) at room temperature for 30 mins. Cells were washed with PBS twice and imaged using EVOS FL Auto microscope (Thermo Fisher)’ - Please report the duration that the cells were incubated with EdU in culture before the cells were fixed and EdU incorporated in the DNA was stained.

    1. On 2022-08-14 23:37:12, user Isaac Larkin wrote:

      Could you add a plot of homopolymer length/frequency distribution in the genome, and maybe a map/table of the longest homopolymers, as a supplemental figure? That will be useful as a point of comparison to the homopolymer basecalling accuracy of the latest nanopore basecallers, since long homopolymers are the primary remaining systematic source of error in nanopore sequence data.

    2. On 2022-08-13 07:43:06, user Isaac Larkin wrote:

      I couldn’t find the Oxford Nanopore flow cell/pore/kit/basecaller versions used, or stats about the ONT read length/quality distributions, either in the preprint or the linked GitHub repo. Those should definitely be specified in the methods section. Also, I don’t see the sequence data for HG00621 at the hpgp-data GitHub repo the preprint says it’s located at. In the repo’s README, I only see links for sequence data corresponding to samples HG01109, HG01243, HG02080, HG03098, HG02055, HG03492, HG02723, HG02109, HG01442 and HG02145. I think the repo’s README needs to be updated to include links to the relevant (HG00621) sequence datasets, in the same way as is displayed for the samples above.

    1. On 2022-08-14 20:38:52, user Ricardo M. Biondi wrote:

      With my colleague Alejandro E. Leroux we have written an extended commentary with our opinion on the work, which can be found in the link: https://www.qeios.com/read/....<br /> In short, we find that the authors do not properly cite previous work, notably the Gao and Harris paper (2006) that reaches similar conclusions. In addition, the introduction fails to acknowledge even basic issues. For example, the classical PKCs are constitutively phosphorylated by PDK1 without growth factor signaling. Akt/PKB becomes phosphorylated by PDK1 in a PI3-kinase dependent manner but also has been described to become phosphorylated by PDK1 in a PI3-kinase INDEPENDENT manner. In contrast to what Levina et al. indicate in the introduction, a model to explain PDK1 phosphorylation of substrates must take into consideration that some substrates are phosphorylated in a PIP3-independent manner! <br /> For a detailed commentary on the results section, again I recommend that you go to the qeios link above. Most of the hard biochemistry in the paper is dedicated to describing the dimer that must be formed along the very very slow process of trans-autophosphorylation in vitro. The hard-core biochemical studies are based on a fusion of PDK1 to PIF. It is difficult to understand what useful information can be obtained from those "dimers"... PIF binds with high affinity to PDK1: what would be the sense of crosslinking GST-PIF to PDK1? would you obtain any information about the GST/ PDK1 heterodimers??? If the model was correct, PIFtide should inhibit trans-autophosphorylation. The authors did not do this control experiment. But it was done previously: this was NOT observed in the paper by Frödin et al (2000). So the dimer model with an important hydrophobic motif binding to the PIF-pocket in the neighbour molecule is very likely incorrect. Finally the authors claim autoinhibition by the PH domain and release of this autoinhibition by PIP3. I have not yet seen any convincing data to support the existence of an autoinhibited PDK1. Please, refer to the qeios link for further details. In short, I believe that the conclusion of this part of the work is also not supported by their data nor by 25 years of careful work by different laboratories.

    1. On 2022-08-11 06:49:50, user Miguel Cañedo wrote:

      Really nice work, congratulations! I wonder if adaptation has any "cost" for the population. Are there any trade-offs? Maybe the adapted populations would be outcompeted by non-adapted populations under certain conditions?

    1. On 2022-08-10 23:02:59, user Moritz Oberlander wrote:

      I was a little bit disappointed that you did not show the proteolysis of C-terminal domain at TTMV-ly1 homologs as well, at least one or two with 99% identity; for instance:

      541 KWGGDLPPMSTITNPTDQPTYVVPNNFNETTSLQNPTTRPEHFLYSFDERRGQLTEKATK TTMV-ly1: French children

      541 KWGGDLPPMSTITNPTEQPTYVIPNNFNETTSLQNPTTRPEHFLYSFDERRGQLTEKATK safia 523-10: Tanzania children

      541 KWGGDLPPMSTITNPTDQPTYVIPNNFNETTSLQNPTTRPEHFLYSFDERRGQLTEKATK xz029-anello-1: China children

      C-terminal domain changes at the TTMV-Ly1 homologs only in positions 557.aa and 563.aa

      I know that anelloviruses are “orphans” but they may have some “siblings". I think it’s important for an infectious study, scaling up VLP production, and to avoid a misleading degradation of the C-terminal domain at the TTMV-Ly1.

    2. On 2022-07-27 18:58:54, user Moritz Oberlander wrote:

      There is an opportunity to discuss the infectious study in the paper J Galmès, 2013 and her French thesis: https://tel.archives-ouvert... with TTMV-Ly1,-Ly2,-Ly3 virus particles in lung epithelia or embryonic kidney cells. It would be interesting to compare them but it seems to me, there is not significant difference in the infection of the TTMV-Ly1, Ly2, Ly3 viral particles (Figure 45).

      I looked at the TTMV-Ly2 because it has two characteristic repeats in the 5’-noncoding region, the second repeat was probably created by the insertion of about 66nts (insert: gccggaaaaccacataatttgcatggctaaccacaaactgatatgctaattaacttccacaaaaca). I searched (Blast) for a homologues direct lineage of TTMV-Ly2 (to exclude a recombination) based on this insert and found several homologues of Ly-2. I wanted to see if they hold a similar spike structure as well. Some lineage-homologs seem to be similar but safia-668-2 and 314-17 may show more changes in spike region of Ly2:

      YTGANLPGDTTQIPVADLLPLTNPRINRPGQSLNEAKITDHITFTEYKNKFTNYWGNP TTMV-ly2 2979nts<br /> YAPGNPPTTPDNIQIADLIPLTNPRENKPGMSLNEAKIGGKTDFNNYKTNYKNYWGNP safia-367-10 2991nts<br /> YAPGNPPTTPDNIQIADLIPLTNPRENKPGMSLNEAKIGGKTDFNNYKTNYKNYWGNP safia-692-0 2992<br /> YAPGNPPTTPDNIQIADLIPLTNPRENKPGMSLNEAKIGGKTDFNNYKTNYKNYWGNP safia-418-10 2941<br /> YAPGNPPTTPDNIQIADLIPLTNPRENKPGMSLNEAKIGGKTDFNNYKINYKNYWGNP safia-569-10 2849<br /> YAPGNPPTTPDNIQIADLIPLTNPRENKPGMSLNEAKIAAKTDFNKYKTNYKNYWGNP safia-388-14 2991<br /> YAPGPPIPTAENLKVGDLIPLTNPRDNVSGESFFEQQTTTHETWKQYFTNYKKHWGNI safia-668-2 2977<br /> YAPGPPIPTAENLKVGDLIPLTNPRDNVSGESFFEQQTTTHETWKQYFTNYKKHWGNI safia-314-17 2977

      FNKHIQEHLDMILYSLKSPEAIKNEWTTENMKWNQLNNAGTMALTPFNEPIFTQIQYN ly2<br /> FNVEIQEHIQDILYSLKSPEAIKSAWTTENMTWKQLDNAGQMALTPFNEPIFTQIQYN safia 367-10<br /> FNVEIQEHIQDILYSLKSPEAIKSAWSTENMTWKQLDNAGQMALTPFNEPIFTQIQYN safia-692-0<br /> FNVEIQEHIQDILYSLKSPEAIKSAWTTENMTWKQLDNAGQMALTPFNEPIFTQIQYN safia-418-10<br /> FNVEIQEHIQDILYSLKSPEAIKSAWTTENMTWKQLDNAGQMALTPFNEPIFTQIQYN safia-569-10<br /> FNVEIQEHIQDILYSLKSPEAIKSAWTTENMTWKQLDNAGQMALTPFNEPIFTQIQYN safia-388-14<br /> FNVHTSEHLEDLLYSLKSPEAIAKKALENENKTDLKWSELDNAANMALTPFDQPIFIP safia-668-2<br /> FNVHTSEHLEDLLYSLKSPEAIAKKALENENKTDLKWSELDNAANMALTPFDQPIFIP safia-314-17

      In the phylogenetic tree, the TTMV5-TGP96 (no the second insert) is the closest homolog to TTMV-Ly2:<br /> YTGTNPPSDTSQIKVADIIAVTDKKNNKPGESYHDQQTTSNKNWQQYFENYQQFWGNP TTMV5-TGP96

      It seems to be difficult to find a direct lineage for TTMV-Ly1 or its homologs with similar structure and discuss that......

    1. On 2022-08-10 17:32:04, user Misha Skliar wrote:

      The revised manuscript is now published in the Journal of Extracellular Vesicles: https://onlinelibrary.wiley.... Compared to the bioRxiv manuscript, the JEV paper includes additional experimental results, such as proteomic analysis of plasma EVs isolated by asymmetric depth filtration. We also added the comparison with a multistep precipitation-purification sequence for plasma EV isolation. The published paper provides a mechanistic explanation of high purity and yields achieved with the developed method. The proposed mechanism is tested by demonstrating the size selectivity for synthetic samples and the selectivity by the elasticity of captured nanoparticles, which we analyzed by capturing rigid and soft nanoparticles (latex beads and pre-isolated EVs) using the developed method.

    1. On 2022-08-09 17:55:17, user SCrosby wrote:

      10x has told us they would rather the samples be cryopreserved vs methanol fixed since it yields better cell quality, higher UMI and gene counts, and lower ambient RNA in the sample. The cells are generally easier to handle (wash, filter, etc) after thawing.<br /> I would be curious it hear the authors' comment!<br /> Seth Crosby

    1. On 2022-08-09 15:01:20, user Uri Ben David wrote:

      Response to “Revisiting the effects of Cas9 on p53-inactivating mutations reveals sex-biased genome editing by CRISPR-Cas9”.

      Authors: Oana M. Enache, Veronica Rendo, Rameen Beroukhim, Todd R. Golub and Uri Ben-David

      A couple of years ago we reported Cas9-induced p53 signaling in cancer cell lines (ref 1). Here, Guo and Xiong address the possibility that this finding is affected by cell line sex biases (ref 2). In their preprint, they are trying to make 3 points related to our paper. We will address each of these points separately.

      1) TP53 mutations also shrink and not only expand upon Cas9 introduction.

      To study the trend of p53-inactivating mutations to expand or shrink following Cas9 introduction, we performed an analysis of pre-existing subclonal mutations (Fig. 3d in ref1). As mentioned in our paper several times, we deliberately restricted this analysis to pre-existing mutations with 0.02<af<0.48 or="" 0.52<af<0.98="" in="" the="" parental="" cell="" line.="" the="" reason="" for="" the="" focus="" on="" subclonal="" mutations="" in="" this="" analysis="" is="" that="" the="" tendency="" of="" mutations="" to="" expand="" or="" shrink="" can="" only="" be="" tested="" in="" subclonal="" events,="" as="" clonal="" events="" can="" only="" shrink="" and="" not="" expand,="" whereas="" non-detected="" events="" can="" only="" emerge="" but="" not="" shrink.="" inclusion="" of="" such="" clonal="" mutations="" would="" therefore="" bias="" the="" analysis.="" we="" found="" a="" highly="" significant="" trend="" for="" subclonal="" inactivating="" tp53="" mutations="" to="" expand="" following="" cas9="" introduction="" (fig.="" 3d="" in="" ref1),="" and="" tp53="" ranked="" 1st="" among="" all="" genes="" in="" this="" respect="" (fig.3e="" in="" ref1).="" in="" contrast,="" guo="" and="" xiong="" used="" different="" selection="" criteria="" for="" inclusion="" and="" exclusion="" of="" mutations.="" two="" of="" the="" shrinking="" mutations="" identified="" in="" their="" fig.="" 1a="" (in="" ovk18="" and="" c2bbe1)="" are="" clonal="" mutations="" (with="" af="" of="" ~0.5="" or="" ~1="" in="" the="" parental="" population).="" we="" argue="" that="" it="" is="" improper="" to="" include="" clonal="" mutations="" in="" this="" analysis,="" and="" it="" is="" clearly="" wrong="" to="" report="" them="" as="" “tp53="" inactivating="" subclonal="" mutations”="" (legend="" to="" fig.="" 1a="" in="" ref2).="" the="" third="" mutation="" that="" they="" identified="" as="" shrinking="" (in="" a2780)="" was="" also="" not="" analyzed="" by="" us,="" since="" it="" is="" a="" known="" snp="" that="" is="" pretty="" prevalent="" in="" the="" population="" (="">1% in gnomAD (ref3); see Supplementary Data 3 and our exclusion criteria described in the Methods section of ref1). We therefore think that it is a mistake to consider this mutation as an ‘inactivating TP53 mutation’ as well.<br /> Importantly, if one were to include the clonal inactivating mutations that Guo and Xiong have added to our analysis in their Fig. 1a2, then there is no justification for the exclusion of mutations that were not detected at all (AF~0) in the parental cell line but were present in the Cas9-expressing cell line, such as the mutation observed in the cell line SNU1 (Fig. 3c in ref1). However, this event was excluded in Fig. 1a of ref2. Similarly, if one were to include known SNPs in the analysis, then there is no reason to exclude the one in the cell line JHH7, which emerged from AF=0 to AF=1 (and was excluded both from our original analysis and from Fig. 1a2). In other words, the inclusion criteria for Fig. 1a of ref2 are inconsistent. <br /> Lastly, if we add the clonal mutations to the analysis (but exclude the known SNPs), there is still a significant trend for the expansion of TP53-inactivating mutations (p=0.03 in a one-tailed McNemar test for directionality). Guo and Xiong’s statement that they found “significantly shrinking inactivating subclonal mutations of TP53 in Cas9-cells, which means Cas9 also selects against TP53 inactivating mutations” (Abstract of 2) is therefore misleading. (We note that Guo and Xiong report that “four inactivating mutations from four cell lines were shrinking (P=0.039)”, but their manuscript does not provide any information about the statistical test that was applied to calculate significance.)

      2) There is a potential sex-bias in our results.

      We did not test whether any of our results were affected by a potential sex bias. Given that p53 has an effect on X chromosome inactivation, we cannot rule out the possibility that sex may affect p53 signaling following Cas9 introduction. However, sex representation in our cell line cohort was very balanced, and Cas9-induced p53 activation and selection were found in both male and female lines. Of the 43 TP53-WT lines used for the gene expression analyses, 21 were female, 21 were male, and one was of unknown sex; of the 122 TP53-mutant lines, 62 were female, 59 were male, and one was of unknown sex. Moreover, we used TP53-WT cell lines from both sexes (3 male lines, 2 female lines, 1 of unknown sex) to validate p53 activation following Cas9 introduction, and detected p53 pathway activation in both the male and the female lines (Fig. 2 and Extended Data Fig. 2 in ref1). Of the 10 cell lines in which a TP53 mutation was found to emerge or expand (Fig. 2c,d in ref1), 6 were female and 4 were male. Therefore, there is no evidence for any sex bias in these results.<br /> While Guo and Xiong raise an interesting hypothesis, they do not provide any real evidence that any of our results were indeed affected by sex bias. Instead, they make a few anecdotal statements on the matter:

      a) “The largest fold-change of p53 activation was observed in a female cell line (BT159)”.<br /> This is meaningless, as we tested the mRNA expression in 165 cell lines and protein expression in 9 cell lines. Guo and Xiong do not report any systematic comparison of the expression changes between male and female cell lines (although all of the data necessary for such analysis are available in our original paper).

      b) “There were more DNA damage foci in MCF7, which is a female cell line”. This assay was performed in only 3(!) cell lines, precluding any meaningful interpretation of sex bias. We also note that Cas9-induced p53 activation was actually mild in MCF7, compared to other male and female cell lines (Fig. 2e in 1), further weakening this particular anecdotal claim.

      c) “The largest TP53-inactivating subclonal mutations expanding or shrinking (293T, HCC1419, and OVK18) is seen in female lines”. This claim does not hold true if OVK18 is removed from the analysis. Moreover, according to Fig. 1a of ref2, 2 out 4 shrinking mutations and 4 out of 10 expanding mutations are actually seen in male lines, so the trend of mutations to expand or to shrink seems to be pretty sex-balanced.

      d) In the final paragraph of their manuscript, Guo and Xiong state that “We think the possible sex-biased effects of Cas9 may provide a possible reason for their failure to detect p53 activation in Cas9-expressing HCT116 (male) cells." This is factually wrong. We found significant activation of p53 in HCT116 cells transduced with Cas9, as is clearly shown in Extended Data Fig. 2d and<br /> 2e of ref1.<br /> We note that the majority of the manuscript by Guo and Xiong (Fig. 1b-d, Supplementary Fig. S1-S4, Supplementary Table S1) is an analysis of sex bias in CRISPR screens, which does not directly pertain to our paper. Sex biases in CRISPR screens may have nothing to do with the Cas9-induced p53 signaling that we observed. Moreover, we compared CRISPR to shRNA screens and found significant differences associated with p53 mutation status (Fig. 5 in ref1). Guo and Xiong do not discuss this at all, nor do they provide any evidence that this analysis was affected by cell line sex bias.

      3) TP53 mutation status of some cell lines is inaccurate in our paper.

      The Supplementary Note of 2 reads: "We found that 11 cell lines (RERFLCAI, SISO, SNU761, COV644, COLO684, HS294T, G292CLONEA141B1, D283MED, G401, SJSA1, and SNU1041) used as TP53-WT (Fig. 5a and Supplementary Data 5 in ref.1) by Enache et al. actually have non-silent TP53 mutations (Supplementary Table S2), although this should not affect their conclusions."

      There are 698 cell lines in Supplementary Data 5 and Fig. 5a, and we clearly did not validate the TP53 mutation status of each individually, but rather followed established annotations. There are several ways to classify TP53 mutation status in cell lines, and mutation calling algorithms constantly evolve. As described in our Methods section (ref1), we followed the annotations by Giacomelli et al. (ref4), which are based on the CCLE cell line annotations (ref5), according to which all of the 11 cell lines listed above are TP53-WT. These annotations have since been updated, however, and in the version downloaded by Guo and Xiong (22Q2, https://depmap,org/portal/), these cell lines are now classified as TP53-mutant. Importantly, exclusion of these cell lines has no effect on the outcome of the single analysis in which they were used (Fig. 5a in 1; p=8.8x10-6 instead of the original p=2.7x10-5; one-tailed t-test). Therefore, the slight discrepancy between the annotations used by us and those used by Guo and Xiong is irrelevant to the points that they raise.

      In summary, we thank Guo and Xiong for raising the intriguing possibility that sex may affect the cellular response to Cas9, in particular in the context of p53 pathway activation. However, this question remains open for now, as more research and data analysis are needed to determine whether this speculation is correct.

      References<br /> 1. Enache, O. & Rendo V. et al. Cas9 activates the p53<br /> pathway and selects for p53-inactivating mutations. Nat Genet 52, 662-668 (2020).

      1. Guo M. & Xiong Y. Revisiting the effects of Cas9 on<br /> p53-inactivating mutations reveals sex biased genome editing by CRISPR-Cas9. This preprint.

      2. Karczewski K.J. et al. The mutational constraint spectrum<br /> quantified from variation in 141,456 humans. Nature 581, 434-443 (2020).

      3. Giacomelli, A. O. et al. Mutational processes shape the<br /> landscape of TP53 mutations in human cancer. Nat Genet 50, 1381–1387 (2018).

      4. Barretina, J. et al. The Cancer Cell Line Encyclopedia enables<br /> predictive modelling of anticancer drug sensitivity. Nature 483, 603–607 (2012).
    1. On 2022-08-04 09:15:32, user Erin Schuman wrote:

      Interesting! Please also check out our very related work (sadly not cited by Yang et al.,) in which we show the exchange of ribosomal proteins (RPs) in neurons, using dynamic SILAC, and show that oxidative stress stimulates the exchange of some nascent RPs on mature ribosomes. <br /> https://www.nature.com/arti...

    1. On 2022-08-04 06:09:03, user Iratxe Puebla wrote:

      Review coordinated via ASAPbio’s crowd preprint review

      This review reflects comments and contributions by Richa Arya, Samuel Lord, Arthur Molines and Sónia Gomes Pereira. Review synthesized by Richa Arya.

      In the manuscript titled “Nanog organizes transcription bodies” Kuznetsova et al. discuss how the transcriptional bodies are assembled. They show that Nanog and Sox19b cluster before the transcription actually starts and initiate the formation of transcription bodies.

      The following comments and suggestions were raised to help strengthen the manuscript:

      1. Result: RNA Pol II transcription localizes to two transcription bodies when zebrafish genome activates…

      The heading of the section is a bit confusing. Does it refer to the transcription of RNA pol II or transcripts of RNA pol II?

      Within the result section: ‘…as 64-cell stage…’ Would be good for the reader to clarify that this is division number 6 to make it clearer that it is way earlier than what is reported in the previous sentence.

      ...productive transcription starts in two transcription bodies in the nucleus. These transcription bodies are isolated, large, long-lived, and appear at a predictable time during development…’. At this stage the study has reported localization data but not activity data (this is included later). The formation of clusters (which is what is detected) might suggest but cannot conclude about the activity of the enzyme or whether RNA is actually being produced.

      1. Figure 1

      …the percentage of nuclei with at least one Pol II (Ser5P or Ser2P) cluster is indicated…’. The injection is happening at the 1-cell stage. Then observations are made at the 64/128/256 cell stage. Are all the nuclei labelled at these stages? or only a subset? Recommend providing some clarification about the percentages reported? Are they a consequence of the embryo being mosaic, some cells containing the label injected at the 1-cell stage and some not? Or is it biological noise? Or a combination of both? Is this the ratio of (# of cells with puncta)/(total # of cells) or is it (# of cells with puncta)/(# of cells containing some labelled Pol II)?

      'C. Tracks of transcription bodies at 64-, 128-, and 256-cell stage. The presence of Pol II Ser5P, Ser2P, or both, is indicated by red, blue, and white circles, respectively. Time on the x-axis in minutes after mitosis.’. The sample size seems too small, can some clarification be provided to help with the interpretation of this data:

      In the first plot, one embryo is 64 cells. Even taking in consideration the fact that the embryo might be a mosaic with 50% of the cells labelled and that one can not image all of the cells due to the thickness of the sample, it should leave a few cells imaged per embryo (5-10 cells). It would be good if one experimental replication was made of multiple embryos injected in parallel. So, with all these considerations, the 20-ish tracks displayed on the first plots seem like a small number. If one experimental replicate is 3-4 embryos and 5 cells can be imaged per embryo then around 20 tracks would be the result of 1 replicate (vs 3 as indicated in the methods). If 10% of the cells can be imaged at 256-cell stage, with 3 replicates each made of multiple embryos, it would give more than 60-ish tracks.

      For wt, N=3, n=111; for mir430 mutant N=3, n=72…’. Please clarify what the two n refer to in the figure legend?

      The methods state "A minimum of 3 biological and 3 technical replicates was generated for each experiment. The number of experimental replicates (N) as well as the number of measured nuclei (n) are reported for each conducted experiment individually in the respective figure legend." - Recommend including a shorter but similar clarification in the figure legend.

      1. Result: Transcription factors cluster prior to, and independent of transcription

      'and visualized each transcription factor in combination with the initiating form of RNA Pol II (Figure 2A, and Movies S4-6…’ Suggest adding a clarification about when zygotic translation starts in zebrafish and whether translation starts before transcription in zygotes.

      We conclude that transcription factors cluster prior to, and independent of transcription elongation.’ From the data it should be possible to estimate a mean delta T from TF clustering to Pol II clustering, it may be relevant to report such a number.

      1. Figure 2: Pairwise non-parametric Wilcoxon tests: There is a concern about the use of a pairwise test as the two conditions CTRL and amanitin are two different conditions.

      2. Result: RNA accumulation results in dissociation of transcription factor clusters

      ‘...the appearance of RNA Pol II Ser5P (initiation) clusters was also delayed in the absence of transcription elongation (Figure 2E)…’. Suggest calculating the delta in time between TF cluster appearance and Pol II cluster (as suggested above). It appears the "delay" in the apparition of the Pol II puncta is the delay observed for the TF, which would indicate that with or without transcription Pol II joins the TF cluster at the same time.

      …while accumulation of RNA causes them to dissolve…’. Is this based on the observation that inhibition of transcription results in a longer cluster lifetime? RNA accumulation might promote clusters to dissolve, but whether it is the "cause" of their dissolution has not been tested. Recommend reframing the fragment to avoid conclusions about RNA accumulation.

      1. Result: Nanog organizes transcription bodies

      '…cycle (Figure 3A)…'. There is a concern about comparing Nanog and Sox apparition time if they are not observed within the same embryo / nuclei. The present data are convolved by variations between embryos and between nuclei, recommend providing some clarification and looking at the time difference between each TF and the corresponding Pol II cluster.

      ...Nanog RNA Pol II Ser5P could still be detected…’. Suggest re-phrasing this part as "to determine if RNA Pol II Ser5P could still be detected in the absence of Nanog".

      1. Figure 3.

      In C-D, the percentage of nuclei with the indicated pattern is indicated…’. Suggest some further clarification about the percentages reported. In C does this indicate that 9 % of the cells form Sox clusters in absence of Nanog? And in D that 27 % of cells form Pol II clusters in absence of Nanog? If that is the case, recommend discussing it as it might impact the conclusion that Nanog is "required" for Pol II clustering.

      'Pairwise non-parametric Wilcoxon tests were performed, ns indicates P > 0.05…'. Reconsider the use of pairwise tests, as noted above.

      1. Figure 4 - ‘percentages indicate how often the shown phenotype is observed. For D and E, N ≥ 3 and n ≥ 18.’ - Please clarify how these percentages are calculated. Is this the percentage of nuclei with the described phenotype per embryo? Or the percentage of embryos with at least one nucleus with the depicted phenotype? In Figure 1 the percentage for Pol II in WT at 128-cell stage is 80%. Figure 4 reports 100%, is it evaluating the same thing? If it is preferable not to write exactly N and n values for all the conditions, maybe these could be shown in the figure itself.

      2. Result: Nanog DBD as well as IDR are required to organize transcription bodies

      In this study we analyzed the assembly of two transcription bodies…’. Recommend placing this under a separate Discussion/conclusions section.

      …and RNA accumulates, transcription factor clusters disassemble.’ It is not clear that the statement is supported by the data, consider reframing the fragment.

      1. STAR METHODS

      Please provide additional details about the different aspects of methodology. Also consider depositing the custom scripts to a public platform such as github or zenodo where these materials can be publicly accessed and referenced, supporting reproducibility.

      Preparation of embryos for use in live-cell microscopy….At 16- to 32-cell stage…’. In the movies (or at least their legends), the embryos shown are at the latter cell stages. Would it be possible to clarify whether later staged embryos were prepared and how? If the approach involved waiting until the desired development stage was achieved, please indicate so.

      Image pre-processing with Noise2Void… The network was trained on and applied to the raw spinning disk confocal data in full 3D with both color channels being present…’. Are there specific parameters that should be specified? How many stacks / movies were used for training? How was it evaluated that the training was sufficient?

      Signal normalization…..The denoised and max-projected 2D image data was normalized…’. Please report the details of the process e.g what was the normalization?

      Determining developmental stage and mid-point between interphases……This method is very reliable as the inter-nuclear distances in these early stages are highly stereotypic…’. Was this method previously described and/or used? If so, please provide references.

    1. On 2022-08-03 21:21:03, user smartalec wrote:

      page 8: "The identity of potential drivers of SCLC metastasis on chromosome 16p, the top gain (Supplementary Fig. S7B), remains unknown, but genomic gain of 16p13.3 has been associated with poor outcome in prostate cancer (48) and this region contains the PDK1 gene, coding for a component of the PI3K/AKT pathway." Its not PDK1 which lives on Chr2. The correct gene is PDPK1.

    1. On 2022-08-03 20:51:43, user Fred Maxfield wrote:

      This study focused on the role of TPP1 in degrading fibrillar β-amyloid in microglia. In the course of a follow-up study, we were unable to reproduce the experiments showing differences in degradation of fibrillar β-amyloid in microglia from wild-type and Tpp1(-/-) mice. We do not understand the reason for the difference, which may be the result of subtle differences in the preparation of β-amyloid fibrils or culturing of the microglia.

    1. On 2022-08-03 10:50:51, user Iratxe Puebla wrote:

      Review coordinated via ASAPbio’s crowd preprint review

      This review reflects comments and contributions by Ruchika Bajajand Michael Robichaux. Review synthesized by Michael Robichaux.

      The manuscript presents a cryo-electron microscopy focused study of a recombinant type V-K CRISPR-associated Cas12k transposon recruitment complex from Scytonema hofmanni that is DNA-bound and includes a complete R-loop formation. In addition to mapping the assembly and interactions within this transposon complex, the study also details the discovery of ribosomal protein S15 as an essential component for the transposition activity of the complex. The work presented in this manuscript may contribute to the development of new programmable CRISPR-associated genome-engineering tools in eukaryotic cells.

      Major comments

      • The figures in the manuscript are generally well-organized and clear. In particular, the 2D diagram of the Cas12k-TnsC complex in Figure 1A is a useful figure panel; however, please consider refining the diagram for readability by replacing the current nucleotide sequence rearrangement with simpler shapes or graphics.

      • For the structural complex models in Figure 2, please consider adding annotations that highlight both the completed R-loop as well as the 122॰ angled confirmation of the PAM distal to proximal DNA, which are both features that are highlighted in the Results section text.

      • The title for the “TniQ nucleates TnsC filament formation” Results section and the title for Figure 4 are both possibly overstated since these mechanistic conclusions are based solely on transposition assay results.

      • In the discussion, please consider revising the language used to describe the mechanism of transposon complex assembly (the model in Figure 7) to better justify a rationale for proposing a “cooperative” assembly mechanism that is based on the data in this manuscript, which is a structural assessment of the whole complex and its sub-complex interactions.

      Minor comments

      • In the first section of Results section, consider adding a description of the recombinant system used to purify the protein complex used for cryo-EM as done for the Figure 1 legend (“V-K CRISPR-associated transposon system from Scytonema hofmanni (Strecker et al., 2019)”).

      • For Figure S1B, the orientation map is not clear, an adjustment to the color contrast may improve the clarity of this panel.

      • For the cryo-EM data in Figures S2, please better define the TnsC oligomer organization (i.e., hexameric, variable). Also for Figure S2, please consider improving the image contrast for the angular distribution images in panel B.

      • For Figure S3, both the incomplete R-loop and the missing Cas12k-sgRNA + TsnC contacts described in the text for this non-productive complex structure are not evident or identifiable in the models presented in the figure. Please consider annotations or descriptions in the figure legend.

      • For Figure S4, please consider defining all rotations and dispositions that make up the conformational rearrangements in the RuvC domain, as described in the Results section text.

      • For Figure 2, please consider adding a 2D diagram of the current complex structure in comparison to previously-reported structural models.

      • The organization of Figure 3 is too busy, please consider re-formatting for clarity.

      • For Figure S8, please consider including a “zoomed-out” image of the Cas12k+S15 structure.

      • In the concluding paragraph of the Discussion section, please elaborate more on how the findings from this work may impact the “genome engineering application of CRISPR-associated transposons”.

      Comments on reporting

      • As outlined in Figure S1, 75K particles were used for the final cryo-EM reconstruction of the Cas12k-TsnC recruitment complex. Please consider discussing the structural elements or discrepancies of the other classified particles.

      • Table S2 and S3 appear to be missing.

      • In the “TniQ recognizes tracrRNA and R-loop” Results section, please specify which TniQ and tracrRNA mutations reduced transposition activity.

      Suggestions for future studies

      Please consider future studies that address the relevance of this transposon complex structure to physiological processes via cell-based assays.

    1. On 2022-08-03 08:06:30, user Prof. T. K. Wood wrote:

      CspD previously linked to persistence and TAs MqsR/MqsA in E. coli. (doi:10.1111/j.1462-2920.2009.02147.x and doi:10.1016/j.bbrc.2009.11.033).

    1. On 2022-08-01 19:15:07, user Donald R. Forsdyke wrote:

      GENOME-WIDE STRUCTURE POTENTIAL COPIED TO PRE-mRNA INTRON REGIONS

      Exons encode proteins and, following Szybalski’s transcription direction rule, their transcribed DNA strands are purine-loaded to impair base parity (A>T, G>C). Since the stems of stem-loop structures require parity (Chargaff’s second parity rule) this decreases the false alerting of immune mechanisms by double-stranded self RNAs (1-3). With their base parity less impaired than exons, structural constraints on introns should be less than those on exons. Thus, with more flexibility in the ordering of their bases, introns would seem to have a higher potential for structure. Indeed, Rangan et al. (4) report that yeast “introns include more non-random secondary structure elements compared to coding regions.” What could these structures be doing? They suggest there might have been evolutionary selection for regulatory elements:

      The widespread presence of structured elements in S. cerevisiae introns raises the possibility that similar motifs and stable secondary structures play a role in introns in higher-order eukaryotes, perhaps forming regulatory elements in human pre-mRNA.

      While this may be partially correct, it should be noted that eukaryotic pre-RNA structures reflect evolutionary pressures acting directly on both the DNA genomes from which RNAs are transcribed and the RNAs themselves (to ensure their proper functioning). The natural editing of RNA transcripts (pre-mRNA to mRNA) would have included both intron removal (as discussed by the authors) and the removal (or modification) of any exon structures that had primarily operated at the DNA level but were unacceptable at the RNA level. Thus, the structural landscapes of mature mRNAs reflect evolutionary pressures affecting both their cytoplasmic functions (e.g., protein-encoding and purine-loading) and the few (if any) remaining nuclear (DNA) level structural functions that happen to be acceptable (i.e., are neutral) at the mRNA level.

      It is a laudable goal to detail accurate RNA structures as they might operate within living cells (4). However, genome-level structure functions should not be forgotten. For this purpose, it is of fundamental interest to compare genes under negative Darwinian selection (slow mutation rate) with those under positive Darwinian selection (high mutation rate). In the latter case, protein-encoding functions in yeast should more effectively out-compete nucleic acid structure functions for a place in exons (3).

      Indeed, when genes under positive selection pressure were examined in higher-order eukaryotes, using computational methods similar to some the authors employ (5), it was found that the base order required for structured stem-loops was more constrained in exons (i.e, less structure). However, the base order required for local intron structures was less constrained (much more structure). Stem-loop potential in introns was conserved more than in exons (6).

      In other words, a dispersed genome-wide potential for structure - such as might be required to support recombination – seemed to have been diverted from exons to neighboring introns (7). If they have not already done so, I encourage the authors in their future work to compare intron structure landscapes in two classes of yeast genes – those conserved under negative selection and those subject to positive Darwinian selection.

      1. Bell SJ, Forsdyke DR (1999) Deviations from Chargaff’s second parity rule correlate with direction of transcription. Journal of Theoretical Biology 197, 63-76.
      2. Barak M, et al. (2020) Purifying selection of long dsRNA is the first line of defense against false activation of innate immunity. Genome Biology 21, 26.
      3. Forsdyke DR (2021) Functional constraint and molecular evolution. Encyclopedia of Life Sciences 2, 1-11.
      4. Rangan R, et al. (2022) RNA structure landscape of S. cerevisiae introns. BioRxiv: (Here) (July 23).
      5. Reuter JS, Mathews DH (2010) RNAstructure: software for RNA secondary structure prediction and analysis.BMC Bioinformatics 11, 129.
      6. Forsdyke DR (1995) Conservation of stem-loop potential in introns of snake venom phospholipase A2 genes: an application of FORS-D analysis. Molecular Biology & Evolution 12, 1157-1165.
      7. Forsdyke DR (2016) Exons and introns. In: Evolutionary Bioinformatics. 3rd edition. Springer, New York, pp. 235-252.
    1. On 2022-08-01 17:29:01, user Pooja Asthana wrote:

      Summary:<br /> In this paper, the authors have employed Microcrystal electron diffraction (MicroED) to identify the positions of hydrogen atoms in hen egg-white lysozyme. The major success of the paper results from the continued improvement of MicroED data collection procedures: 35% of hydrogens contained in the structure can be visualized with visible hydrogen bonding networks and hydrogens on water molecules. They were able to locate more hydrogen atoms in the protein backbone than in the side chains owing to more rigidity of the backbone structure. They observe density for acidic side chain residues and their negatively charged side-chain carboxyl groups which are thought to be poorly resolved in single particle cryo-EM at moderate resolution. This observation is tantalizing, but incomplete. By our eye in Fig 2c the “right oxygen” in Asp18” is lower signal than the “left”. Presumably this indicates that the side chain is not protonated - and it is possible that there may be opportunities here to test the strength for “for negatively charged atoms at lower scattering angles” based on such differences in signal. Such an analysis would be very interesting (and potentially using different truncations of the data, truly test this model). The last section of the paper describes that the inter-nuclei distances are more accurate to determine the hydrogen bond lengths than the center of mass of electron clouds, which agrees with the analysis in Molprobity (Williams et al, Protein Science 2018). Comparison to X-ray (which occurs a bit in the discussion) and neutron data (e.g. https://pubmed.ncbi.nlm.nih... on this point would be very interesting. Further missed opportunities include comparisons of the h signal strength to detection by neutron/X-ray and whether there are any trends that would connect with hydrogen-exchange measurements.<br /> Overall, the paper is concise and focuses on the observations enabled by the new data collection improvements, but misses opportunities to connect to other analyses on lysozyme (perhaps the best system to make such comparisons in!)

      Following are some minor points that we would like to mention:

      Minor points:

      Abstract line 18: instead of “informing” it should be “information”

      Line 61: “Here, hydrogen atoms were identified by omitting them from the model and inspecting the peaks in a calculated Fo–FC difference map following refinement in Servalcat based on crystallographic refinement routines implemented in REFMAC5 (Murshudov et al., 2011; Yamashita et al., 2021). Since resolution is a local feature in cryo-EM, the accuracy of hydrogen identification varies across the map.”<br /> There is some ambiguity in the way we read this. By “here” do the authors mean in the previous single particle EM work to high resolution outlined in the preceding sentences or their current manuscript? If they mean the preceding papers suggest starting the paragraph, “In those works,”; if they mean the current manuscript, the statement about resolution varying across the map needs a more full and nuanced explanation.

      Line 91: “Lowering the total exposure also reduces the effects of radiation damage that can affect the structural integrity of the protein and the ability to localize hydrogen atoms”<br /> It would be interesting to test the radiation damage directly here, but maybe prohibitive across 16 crystals?

      Line 110: ‘‘Nevertheless, these results are the most complete hydrogen bonding network visualized to date by macromolecular MicroED’’ <br /> The authors did a nice comparison of all the hydrogen bonds based on X-ray, MicroED and neutron diffraction. It would be worth mentioning if they were able to identify any new hydrogen bond position or network which was not previously reported, this would further connect to the other methods as mentioned above.

      Line 127-128: ‘‘Interestingly, whereas the Asp52 and Gly54 N-H distances are close to the idealized positions, the difference peak for the Asn44 N-H is located at an almost equal distance shared between the donor and Asp52 carbonyl acceptor’’<br /> Which idealized positions are the authors referring to? idealized from the neutrons or X-ray or both? There may be settings in Phenix that allow this to be controlled (although REFMAC is used here).

      Line 182/183: ‘‘The number of observations for some 183 bond types is insufficient for a rigorous statistical analysis’’<br /> The authors can mention which bond observations are significant and the observed bond length elongation. For example, C-H2 has the highest number of observations (99) with a deviation of 15. However, there is no mention for the apparent elongation of bond length in this case.

      Figure 2d: Label the contour level for the 2 additional water molecules w1079 and w1005.

      Figure 3: Legend needs explanation for MicroED curve too.

      Supplementary Table 1: We understand that the overall crystal quality statistics are weak in the case of MicroED. However, the low completeness after merging 16 datasets is not entirely understood and perhaps deserves some comment here. Is there a preferred orientation on the grid that leads to a systematic problem in filling reciprocal space?

      Pooja Asthana and James Fraser (UCSF)

    1. On 2022-07-29 13:28:13, user Iratxe Puebla wrote:

      Review coordinated via ASAPbio’s crowd preprint review

      This review reflects comments and contributions by Richa Arya, Joseph Biggane, Luciana Gallo, Arthur Molines, Sónia Gomes Pereira. Review synthesized by Vasanthanarayan Murugesan.

      In this preprint, the authors describe a novel pathway that maintains protein homeostasis in cells recovering from heat stress termed stress-induced protein disaggregase activation pathway (siDAP). siDAP induces the DNAJA1+DNAJB1-Hsp70 protein disaggregase and targets aggregates of tightly misfolded proteins. This pathway is distinct from more-known ubiquitin-dependent quality control and works in sequence with it. Further, the authors show that this pathway is compromised in aging cells. The authors have provided a wealth of convincing data to support the claims made.

      The following items were raised:

      Major comments

      Manuscript

      It is recommended to revise the manuscript to better integrate the data and the text. The paper provides extensive data to support the study claims, but further background material for the experiments in the introductory or results section would support interpretation e.g., concepts required to understand the final two figures are not discussed in the introduction.

      Reducing the number of supplementary figures may make the manuscript easier to follow and help in tightening the narrative.

      Experiments

      Results ‘Immediately after HS, DNAJA1 and DNAJB1 rapidly relocalized to nucleoli’ - It is unclear from the DAPI stain what happens to the nucleolus at 0h after HS. It seems to be present in some cells but not all. Could a marker of the nucleolus be used and/or some clarification included?

      Results ‘This suggests that predominantly newly synthesized DNAJA1 and DNAJB1 molecules drive the assemblage of the DNAJA1+DNAJB1-Hsp70 disaggregase in cells after HS’ - Fig S5D shows that B1 forms puncta after HS even in CHX treated cells, which suggests that protein synthesis is not needed. Can some clarification be added for this fragment.

      Results ‘diffuse GFP fluorescent signal (cyan) indicating that protein aggregates were largely absent’ - The presence of aggregates or puncta before HS cannot be ruled out, the puncta or aggregate could be too small to be resolved. Recommend commenting on this.

      Results ‘Blocking Hsp70 activity by VER-155008 also caused DNAJA1+DNAJB1 scaffolds to persist up to 24h after HS, presumably due to their continuous association with the aggregates (Figure 2D).’ - The HSP70 aggregates look different after treatment with VER, they look more like the A1/B1 puncta than in the DMSO condition, it may be worth commenting on this.

      In Figure 6, the distinction between biological aging and replicative aging could be stated more clearly. Cell lines derived from donors of different biological ages form siDAP puncta and recover from heat shock. However, the cells lose this ability when cultured in dishes at passage 12 or 18 irrespective of biological age. Hence it is not clear if passaging cells mimics biological aging with regard to protein homeostasis.

      Minor comments

      Figure 1H: Recommend including some comments on why the size of HSF is more at 0 hr, and commenting on whether HSF-1 depletion changes HSP70 levels.

      Figure 2 (B-D) - The size of cells in U vs 0 hour appear different, the 0 hr cells look bigger. Suggest adding a scale bar and clarification on whether the magnification is the same.

      In Figure S4/S5, it is hard to infer the state of the nucleolus during stress with DAPI staining and subsequently the localization of DNAJA1 and DNAJB1 to the nucleolus is not clear.

      In Figure S4D, it is shown that CHX doesn’t affect the formation of puncta but the text states that newly synthesized DNAJA1 and DNAJB1 are required for the assembly of DNAJA1-DNAJB1-HSP70. Please provide some clarification for this contradiction.

      In Fig S8, statistical analysis of different siDAP induction is suggested.

      In Fig 3, please provide clarification for the choice of experiments in CHX-treated cells for testing the effect of VER-155008.

      In Fig 5, the caption mentions cells with/without VER-155008 treatment which cannot be seen in the figure.

      In fact, we found that human cells can tune the activation of siDAP according to the level of protein damage sustained after HS’ - It may be informative to check if the cytotoxicity levels differ from HS at 39ºC and at 42ºC.

      In Fig 6, quantification of PLA^Dt, similar to Fig 1F is suggested. Please also report the conditions used for heat shock in these experiments, 42oC for 2 hrs?

      Moreover, siDAP was fully active in all fibroblast lines tested (Figure 6A; Figure S22A and B). Similar to immortalized HeLa cells, primary dermal fibroblasts only induced the DNAJA1+DNAJB1 JDP scaffold after HS (Figure S22C)’ - May be worth mentioning that the apparently higher intensity of the fluorescence signal in the cells derived from aged subjects. The fluorescence signal per cell looks much greater in 70 yo (Fig. S22 only) and 75 yo (Figs. 6 and S22). The next few lines discuss the relevance of decreased fluorescence (representative of loss of siDAP induction) with serial passaging/replicative age. However, upon HS, siDAP signal seems to go up with chronological age, but then in the replicative aging experiments, siDAP is lost quickly.

      Discussion ‘There is some evidence to suggest that cellular surveillance systems that usually keep protein aggregation in check deteriorate during aging….’ - There may be some conflation of biological aging and "replicative aging". There seemed to be conflicting results when looking at differently biologically aged samples, which may affect interpretation of whether replicative aging in a dish recapitulates aging processes.

      Methods Cell culture - Please provide further information about the age and other details for the 6 primary fibroblast cell lines.

      Recommend increasing the size of the microscopic image panels in several figures to better highlight the features mentioned.

    1. On 2022-07-29 11:32:47, user Iratxe Puebla wrote:

      Review coordinated via ASAPbio’s crowd preprint review

      This review reflects comments and contributions by Ruchika Bajaj, Rasmus Norrild and Akihito Inoue. Review synthesized by Bianca Trovò.

      Antibody-based technologies for the detection and quantification of analytes in complex biological samples present challenges regarding the infrastructure and chemical modifications involved. There is therefore interest in developing alternative biosensor platforms that leverage split luciferase enzymes. Single-component luminescent biosensors can be more easily produced and work in both homogenous and immobilized assay formats. The manuscript reports the design of BAT, a single-component, NanoLuc-based, Binding Activated Tandem split enzyme biosensor for the detection of the SARS-CoV-2 spike protein in multiple assay formats.

      The reviewers praised the efficiency and practical value of the reporter system described, as the reporter protein works even in crude bacterial cell lysate, as well as the novelty of the mechanism of action for the reporter system. A few comments and suggestions raised are outlined below.

      Major comments

      • In the introduction, the manuscript mentions the single-component, NanoLuc-based, Binding Activated Tandem split enzyme (BAT) biosensor, which is said to “not rely on a large conformational change in the binding module or competition with a tethered decoy as with other single component platforms”. The manuscript argues for the uniqueness and generality of the BAT approach based on a mechanism that does not rely on conformational change. Further references and explanation for the mode of action would be helpful to support the argument. Given the lack of conformational change in the binding module, can an explanation be included for what causes the split components to come closer and reconstitute again?

      • Results, Design and optimization of SARS-CoV-2 biosensor “S-BAT”: the explanation of Figure 1a and Figure S1f provided in the context of the model for the mechanism of BATs could be strengthened with crystal diffraction data to validate the hypothesis, especially for clarifying how steric hindrance occurs when binding with the antigen (although this will not elucidate any conformational change happening in LCB1 upon binding).

      • Results, Design and optimization of SARS-CoV-2 biosensor “S-BAT”: the manuscript reports a full mutational analysis, or deep mutational scanning (DMS) leading to the generation of “a point mutant in the S-BAT binding module at Asp30 (“S-BAT*”), designed to ablate salt bridges formed with Lys417 and Arg403 in the Spike receptor binding domain (RBD)”. Would it be possible to have this mutation motivated in the manuscript, and why was it chosen over other possible mutations in that context?

      • Results, Design and optimization of SARS-CoV-2 biosensor “S-BAT”: the statement that “the absence of a hook effect at super-stoichiometric concentrations of Spike binding sites to sensor copies supports a predominantly cis activation mechanism” is a strong point but further clarification on this point is recommended, for example, further context on the Hook effect, and what would have been expected if trans activation was the major mode of action.

      • Discussion: the manuscript has shown different versions of the same assay, so a discussion on advantages of one version over the other would be important.

      Minor comments

      • Results, Design and optimization of SARS-CoV-2 biosensor “S-BAT”: “In addition to having high thermal stability, rigidity, and no disulfide bonds to complicate purification” - Please clarify which protein these qualities refer to.

      • Results, Design and optimization of SARS-CoV-2 biosensor “S-BAT”: “This suggests that cis activation is likely the predominant source of signal in the assay, but we cannot rule out the contribution of a trans activating mechanism. In the trans mechanism, simultaneous binding to multiple protomers in a single Spike might increase the effective concentration, driving activation.” - Please provide further comments on the cis and trans mechanisms.

      • Results, S-BAT is functional in multiple assay formats: “Adsorption-based immobilization is advantageous in that it requires no chemical modification to the protein reagent”, recommend reporting the efficiency of this step and how much signal is left after the washing steps.

      • Methods, Cloning: the manuscript reports that all BAT constructs were subcloned using NcoI and BamHI restriction sites via Gibson assembly. Restriction site cloning and Gibson assembly seem to be two orthogonal methods, suggest providing further information on the cloning procedure.

      • Methods, Recombinant Protein Production: "The un-cleaved BAT sensors were concentrated to ∼1.0 mL, and the concentration was calculated from the A280 value”. It is unclear if this was done using highly pure imidazole or if the signal was subtracted from Imidazole? A280 quantification is known to be difficult with Imidazole present.

      • In Figure 1c: “Performance (Signal to Noise (S/N) multiplied by the magnitude of signal change (S-N))” please provide the mathematical expression for this analysis

    1. On 2022-07-29 06:13:30, user liu xuyang wrote:

      This paper use self-distillation dataset to learn protein folding. But this self-distillation training dataset are inferenced by alphafold, not by model itself. I wonder if it really learned how to fold a protein structure or just remembered this protein looks like from alphafold inferenced structure. Maybe you can make a testset with less than 30% or 40% sequence identity to all training data, and see it's performance. I think it can test if this pretrained language model really learned something.

    1. On 2022-07-27 14:46:46, user Karen Lange wrote:

      Overall this is a very thorough study looking at the roles of Septin9 and ARHGEF18 in ciliogenesis. I especially like Figure 3 where the authors compare the severity of partial knock down of SEPTIN9 with siRNA vs in the knock-out CRISPR cell line. The complete lack of cilia in Figure 3J/K is very striking. The experiments using centrin-fused RhoA and ARHGEF18 are very creative. It is impressive how long the cilia are in Figure 5D! I find it interesting that expressing the Centrin-GFP-DHPH construct doesn’t cause the same long cilia phenotype in the Septin9 KO cells. This observation is based on the images shown in the panels because I do not see cilia length measured in Septin9KO + Centrin-GFP-DHPH.

      I appreciate the use of scatter plots to highlight the variability/reproducibility of the data. I assume the different colors relate to different replicates, but this is not clearly stated.

      I have a few specific comments with regards to Figure 7:

      I found it difficult to see the 3 RPGRIP1L puncta. I think if the panels were more zoomed in or larger it would help to better highlight the shift from 3 to 2 puncta in the Septin9 KO cells.

      In the Septin9 KO cells RPGRIP1L and TCTN2 staining was not observed at the transition zone. This observation is not surprising since the Septin9 KO cells do not have cilia (Figure 3J/K). As such, I do not believe that the conclusion that Septin9 “mediates the localization of transition zone components to the ciliary base” is founded. Septin9 could have a function early in ciliogenesis that is not necessarily specific to mediating the localization of transition zone components. Perhaps this could be better resolved in the Septin9 siRNA knock down where short cilia are present.

      The data showing that expression of constitutively active RhoA restores RPGRIP1L and TCTN2 at the transition zone (7I,7J,7M,7N) is very nice and consistent with this construct restoring cilia in the Septin9 KO. However, I think the data in 7M and 7N would be clearer if you included the Sept9 KO data on this graph.

      One last point – Figures 7A, 7B, and the inset on 7C state RPGRIP1 while the text only refers to RPGRIP1L. The Materials and Methods do not mention which antibody was used so I am not clear which protein was the focus of this study. Similarily, I think it is a typo in 7F and the Figure 7 legend where it says TCTN1.

    1. On 2022-07-26 16:45:31, user Andy Villunger wrote:

      Hi Sebastian, this is highly interesting stuff, but I think the title is a bit of a stretch and makes too strong a claim right now. Using the BH3 swap mutants is nice, but does not tell you much about the activity of the full-length (endogenous) protein. You may be aware that the "BH3-only" version of BCL-G is barely expressed in most cells and the version with BH2 & BH3 domain is much more abundant (PMID_23059823). So, studying the BH3 domain in isolation appears somewhat artificial to me. Also, in the CT26 xenotransplant experiment you show would benefit from overexpressing a BH3_mut version of BNIP5 and some data that documents it is really impaired BAK-dependent cell death that gives the growth advantage.....there could be many alternative explanations. So, comparing CT26 lacking Bax or Bak ± BNIP5 wt vs. mut would be a strong experiment to test your hypotheses. Happy to chat more.....

    1. On 2022-07-26 09:48:35, user Iratxe Puebla wrote:

      The study reports single-cell intracellular pH (pHi) measurements in different cell lines to measure spatiotemporal pHi dynamics during cell cycle progression. The manuscript reports an increase in pHi at the G2/M transition, decreased pHi at the G1/S boundary, S/G2 boundary, and prior to division, and increases during mid-S phase and G2, and suggests that pHi dynamics are necessary for cell cycle progression.

      The reviewers praised the topic of the study, measuring intracellular pH during the cell cycle and looking at the heterogeneity between cells are both important questions. However, there were some questions raised about the methodology as well as the interpretation of the data, as outlined below.

      Comments about methodology

      The pH sensor used in the study has been used previously but the single-cell level use requires new types of control and validations. It would be relevant to report:

      • What is the measurement error?
      • How efficient is the permeabilization protocol?
      • How homogeneous is the expression of the sensor? How does the expression level impact the pHi readout?

      These technical parameters could explain the heterogeneity in pHi reported in Figures 1,2,3, and they are relevant to understand if the fluctuations reported are relevant biologically or at the level of technical variability.

      Recommend providing additional details on the methodology for single cell pHi measurements, to ensure the experiments can be fully reproduced. Please report sample sizes.

      There is apparent intra-cellular heterogeneity present within each cell. The text should highlight whether the cytoplasm is heterogenous in pH. The study uses a single ROI per cell to measure intracellular pHi, however, if the cytoplasm is heterogeneous as some images show, the location of the ROI can influence the readout. It is recommended to use image analysis tools to segment cells and use the whole signal rather than a selected portion.

      There are concerns about the statistical analysis for several figures (including Figs 2I, 3I, and 5), in particular regarding the calculation of p-values based on multiple measurements or cells within each sample. The t-test and ANOVA assume that each measurement is independent, while multiple nuclei within the same sample are not independent. Recommend not reporting p-values or averaging together the values from each sample and then calculate the p-value using those sample-level means. For more information, see https://doi.org/10.1371/jou... and https://doi.org/10.1083/jcb...<br /> The median is used as the reporter of the populations, the context for this choice is unclear. There are concerns about reporting standard deviation to estimate the spread around the median.

      Specific comments

      Introduction ‘In normal cells, intracellular pH (pHi) is near neutral (∼7.2)...’ - Could the text specify the type of cells the statement relates to, does it apply to all eukaryotes, mammalian cells, or even more specific and only demonstrated for human cells?

      Results ‘single-cell standardization is performed using buffers of known pH containing the protonophore nigericin (Fig. 1A, see methods for details).’ - The experiments use two pH extremes (~6.7 and 7.7 per the Materials & Methods)) and assume a linear relationship of the emission ratio between these extremes. Is this linear relationship verified? The supplementary Fig S2. shows an increase in signal across just two points. Suggest presenting an analysis of the biosensor across 4-5 different pH points to demonstrate linearity and dynamic range within the first set of figures. Plotting the ratio as well as the fluorescence intensities of individual channels across these pH ranges would also be relevant.

      Figure 1

      • Is there an explanation for the signal from the nucleus? It seems initially more acidic than the cytoplasm and then it does not change as much as the cytoplasm during the nigericin treatment. Is this due to bad permeabilization?
      • B) NL20, C) A549, and D) H1299’ - Please indicate which cells are normal and which cancerous.
      • E-G) Histograms of single-cell pHi in E) NL20 (n=173, 3 biological replicates), F) A549 (n=424, 4 biological replicates), and G) H1299 (n=315, 3 biological replicates).’ - The distributions are aggregates of 3 or 4 biological replicates. What do the distributions look like in each replicate? Are the differences between conditions visible? If the E, F and G histograms are generated using data pooled from different replicates, recommend separating the replicates and presenting the distributions separately for each replicate experiment.

      We next measured single-cell pHi in individual NL20-mCh-pHl (Fig. 1B), A549-mCh-pHl (Fig. 1C), and H1299-mCh-pHl (Fig. 1D) cells’ - From the methods: "Individual Regions of Interest (ROI) are drawn for each cell in each condition (initial, high pH nigericin, and low pH nigericin), and mCherry aggregates are removed using thresholding holes." From the cells in the image, it appears that the cytoplasmic signal is not homogenous and suggests that the choice of ROI will affect the reading for each cell. In this condition, to do single cell measurements, it is recommended to use the signal from the entire cell (cytoplasm) rather than using an ROI.

      Representative pHluorin and mCherry channels and single-cell standardization lines can be found in Fig. S2’ - The pH probe appears to be comprised of a straight fusion between the pH sensitive GFP (pHluorin) and pH insensitive mCherry. One would expect that the ratio of GFP to mCherry is only determined by pH (and not by expression level or excitation intensity). A question arises around the dynamic range (shown in fig. S2) being different between the different cell lines. For instance, the ratios observed for pH=7 and pH=7.8 are 3 and 8 for NL20, 3 and 5 for A549, and 0.5 and 2 for H1299. Can an explanation be provided for the differences between cell lines? Were the single cell measurements verified with a dye (BCECF/SNARF/SNAFL)? Was the permeabilization protocol validated?

      (NL20-mCh-pHl) (Fig. 1E; 7.42±0.07).’ - The first sentence of the results section indicates "In normal epithelial cells, pHi is near neutral (∼7.2), while cancer cells have a constitutively increased pHi (pHi>7.4)." According to this statement, the NL20 cell line has a pHi corresponding to cancer cells, can this be clarified?

      These data show the advantages of measuring single-cell pHi under physiological culture conditions that match population averages, but also provide pHi distributions lost at the population level.’ - The single cell data reveal the heterogeneity, can further explanation be provided for the advantage gained by these data over bulk measurements?

      These data also show that pHi is heterogeneous even in clonal, genetically identical, cell lines, suggesting pHi may be a biomarker for non-genetic cell phenotype’ - The data show heterogeneity, but do not address how much and what the source of heterogeneity is. It would be helpful to: report the error on the measurement, compare the spread of pHi to something else to get a sense of the normal level of noise in the measurement. Could this be compared to the spread of mCherry intensity, to check if there is more spread in pHi than in expression level of the construct.

      Independent measurement of the heterogeneity of the pH (e.g. with another probe/dye) would shed some light. The heterogeneity (or spread) of basal biosensor distributions could be compared against the distributions achieved after nigericin treatment - to bring out the differences in biological heterogeneity versus measurement error. The results could then further elaborate on whether the biological heterogeneity has relevance in the regulation of cellular processes.

      pHi in physiological environments’ - Can some clarification be provided for how prior studies did not follow physiological conditions, while the current set up would provide such physiological conditions?

      We synchronized H1299-mCh-pHl cells using Palbociclib’ - The study uses H1299 line in most figures hereafter, A549 line in some while not the NL-20 lung cells, can some justification be provided for the selection of cell lines for specific experiments.

      In this representative replicate, we observed single-cell pHi significantly decreased between 0 and 4 h, significantly increased between 4 and 8 h, decreased between 8 and 12 h, and increased again between 12 and 24 h (Fig. 2D).’ - It is not clear whether these data are consistent with the other replicates (Figure S3). For example, another replicate shows a consistent decrease of pHi between 0-4h and 4-8h, which is not the case for the example shown in the main figure. Can some clarification be added about discrepancies between replicates. In Figure S3 the different time points were statistically compared to their previous time point, can the same statistical analysis be applied to the replicate in Figure 2?

      Figure 2

      ‘Box and whisker plots of F) cyclin E1, G) cyclin A2, and H) cyclin B1 immunoblot data across 3 biological replicates’ - There is a concern about the use of boxplots for n=3 as they summarize the data into 5 statistics (2x whiskers, Q1, Q3 and the median): www.nature.com/articles/nme.... It is recommended to show the individual data with a dotplot.

      Figure 2I. Violin plots of raw pHi across 3 biological replicates’ - A superplot is recommended for identifying the biological vs. technical replicates: https://doi.org/10.1083/jcb.... The significance should be determined based on n=3 (not on the pooled technical replicates).

      Cyclin immunoblots and pHi agreed across 3 biological replicates, and additional blots are shown in Fig. S3.’ -The replicates from Fig. S3 and Fig. 2 do not appear to show a clear behavior. For example at 4h, two replicates show a decrease while the third shows an increase in pHi. Could some clarification be added for this?

      When pHi measurements on Palbociclib-treated cells were compared over three biological replicates, we found that pHi significantly decreased at the G1/S transition (4 h, 7.75±0.15) and in late S phase (12 h, 7.69±0.09), significantly increased at G2/M (24 h, 7.82±0.11) (Fig. 2I), and then significantly decreased once more at the end of the experiment in asynchronous cells (36 h, 7.67±0.10) (Fig. 2I).’ - The population in Fig 1 shows a large spread from around 7.4 to 8. This emcopasses all the distribution shown in Fig 2 and if the individual time points are undersampled, small fluctuations are expected in the mean and the median. Can some comment be provided about the potential influence of undersampling on the fluctuation? If the fluctuations were due to undersampling they would be random and could explain why the replicates are not in very good agreement. Also, can some clarification be added about how many cells were measured in each time point.

      Figure 3 - The various replicates provided here and in Sup. Fig. 4 show variability. For example, only the replicate in the main figure shows a decrease at 4h and 12h. The third and fourth replicates are in good agreement and for those pHi stays roughly the same and then drops between 12h and 24h. Should this be reflected in the text?

      From the values on the y axis for each time point and replicate, it seems that the sample size varies between replicates. There is the risk of undersampling, and also that if one replicate contains much more cells than others, it would dominate the distributions once the data are pulled together. Can the sample size for each time point and replicates be reported?

      and decreases at 12 h and 24 h (Fig. S5B-C)’ - The text previously reported that pHi increased between 12 and 24h for H1299 cells, here it reports that there is a decrease at 24h. Please provide a clarification.

      we established a time-lapse approach to track pHi dynamics over an entire cell cycle in a single cell.’ - This is a robust approach to detect pH changes over time.

      ‘we selected prophase as a “normalization point” for each individual dividing cell’ - Recommend referring to "synchronization point" instead of ‘normalization’.

      Figure 4

      The paper shows that synchronization alters baseline pHi. Could a similar experiment be completed without synchronization?

      ‘A) Representative stills of Video S1 of a dividing H1299-mCh-pHl cell at indicated time (h)’ - It would be good to compare this to the metastatic cells used to establish how much of the pHi fluctuations observed during the cell cycle are "cancer" related.

      Furthermore, the pHluorin increases observed over time in dividing cells are not correlated with increased mCherry fluorescence, which indicates pHluorin increases are not due to increases in biosensor expression (Fig. S8B-C).’ - It is great that this measurement was completed. However, from the plots provided Sup. Fig. 8 B and C, in dividers and non-dividers, it looks like the two signals (mCh intensity and pHluorin) are well correlated (first a decrease for a few hours, then it rises until 10h then it decreases). Could this indicate that the readout is influenced by protein concentration / expression? Suggest plotting the two signals vs each other’s on a scatter plot and formally testing for correlation.

      Figure 5

      For the FUCCI reporter, plotting mVenus and mCherry intensities normalized between the max and min value for each cell allows clear identification of transition between phases. It may be helpful to present example single cell traces from 5-10 cells for each treatment, to more clearly appreciate the cell cycle phase transitions and their durations on panels F,G and H.

      ‘D) Single-cell pHi of H1299-FUCCI cells treated with EIPA and SO859 (E+S, n=233) to lower pHi, untreated (CRL, n=267), or treated with ammonium chloride (NH4Cl, n=202) to raise pHi (see methods for details)‘ - Please clarify how or when delta pHi was calculated for data in Fig. 5D.

      previous work in lower- order organisms’ - "lower-order" has a negative connotation, please consider re-phrasing to include the species or at least family of organisms.

      Discussion - Recommend further discussion about altered progression through cell cycle phases at different pHi and how it could be altered in cancer cells. Is increased intracellular pH in cancer cells related in any way to their increased proliferation? If so, which cell cycle steps are affected? High intracellular pH seems to elongate all phases except the M phase.

      Methods

      Multiple Z-planes were collected with the center focal plane maintained using a Perfect Focus System (PFS).’ - Please report whether pH was analyzed on a projection, a single z-slice, each z-slice?

      Single-cell pHi measurements - Please provide additional detail for the protocol for the single cell pHi measurement. Include information on whether the work involves single image, stacks, projections, etc, and the size and location of the ROIs. Please also provide further context for the "mCherry aggregates", does this mean the construct is cleaved and the mCh aggregate? Does the GFP aggregate too?

      NIS Analysis Software//GraphPad Prism - Please report the version of the software used.

      Individual Regions of Interest (ROI) are drawn for each cell in each condition’ - Could the ROI on a few of the cells be drawn and highlighted in the main figures to show the size and location of the ROI?

      ‘8% laser power for GFP; 700 ms exposure time and 10% laser power for TxRed; and 100 ms exposure time and 5% laser power DAPI’ - Please report the exact wavelengths used to excite the fluorophore, (e.g. 8% power of a 488 laser (GFP excitation)).

      Supplementary figures

      Figure S3 panel A - Should the calibration slope be the same for every cell? Can some explanation be provided for why some cells have a steeper slope than others?

      Figure S4 - Replicates appear to show different trends in pHi and Cyclins, which makes it difficult to interpret the data.

      Figure S8 panel A - This plot shows correlation between the two quantities, they both rise and fall at the same time. Can some clarification be provided.

    1. On 2022-07-26 03:42:41, user MarkD wrote:

      For the most part. this paper treats gene annotations as an opaque collection that is used regardless of the specific type of gene.

      It is especially fascinating that RefSeq has genes that don't have exons.

    1. On 2022-07-22 22:26:51, user Guillermo Gómez wrote:

      Amazing findings! exNef was my PhD thesis and in those days (2005) I insisted that Nef by itself was able to cause severe immune depression independent of viral replication. Here in bioRXiv we published in Dec 2021 that ORF8 is the "Nef" of COVID-19, ie, a superantigen with enough abilities (at least in silico) to cause disease. Happy to see that research about viral toxins are still alive!

    1. On 2022-07-22 15:49:08, user Still Too Slow wrote:

      Lines 25/26: 75.6 ± 0.6 mmol C/L day; 0.06 g/L "day" - the "day" should be hour

      Also the mmol C is not intuitive. I spent way too long working out the rates to figure out why the rates and concentrations weren't meshing.

    1. On 2022-07-21 15:49:11, user Marie-Cecile Caillaud wrote:

      eLife Sciences Publications, Ltd

      https://doi.org/10.7554/eLi...

      Manuscript has been accepted

      Acceptance Date 2022 Jul 9

      Publication: eLife

      This paper has been accepted for publication so its publisher has pre-registered a Crossref DOI.

      This persistent identifier and link (10.7554/eLife.73837) can already be

      shared by authors and readers, as it will redirect to the published

      article when available

    1. On 2022-07-20 09:54:59, user Herranz Lab wrote:

      Amazing work!<br /> I was trying to check some of the Supplementary Table data, but I can't seem to be able to download it. Are you planning on making them available/downloadable too?<br /> Thanks

    1. On 2022-07-19 18:14:29, user T Sawaya wrote:

      I'm wondering if you could publish the disaggregated data for immunity against BA.4 and BA.5 separately. In the abstract, you mention this vaccine providing neutralizing antibody titers against BA.4 but in the figures, BA.4 and 5 figure together. I wonder if that means the Novavax vaccine isn't protective against BA.5 or if it was just a typo in the abstract on your end. Either way, it would be helpful to see antibodies against BA.4 and BA.5 separately and if that is not possible, have an explanation as to why they were aggregated.

    1. On 2022-07-18 12:50:30, user Marc RobinsonRechavi wrote:

      Dear authors,

      I noticed that sequencing data was generated in this study, but there is no declaration of availability. Can you please deposit the data and provide availability in the manuscript?

      Best regards<br /> Marc

    1. On 2022-07-18 10:31:38, user Prof. T. K. Wood wrote:

      There is little doubt that S. pneumoniae, as probably all bacteria, make persister cells, but Fig. 5 shows there is primarily cell death still occurring at 25 hr, not persistence being studied. Arguably, the rate of dying has decreased but persistence is not reached. Also, there is little credible evidence that TAs are involved in persistence (line 343).

    1. On 2022-07-18 09:58:46, user Irilenia Nobeli wrote:

      NOTE FROM THE AUTHORS:<br /> We are currently investigating the implications of counting reads across overlapping features in prokaryotic genomes that may affect the results and conclusions of this manuscript. If this turns out to be the case, we will be deleting this manuscript from bioRvix. If not, we will simply upload a newer version.<br /> Please watch this space for updates.<br /> I.N.

    1. On 2022-07-16 07:41:26, user Iratxe Puebla wrote:

      Review coordinated via ASAPbio’s crowd preprint review

      This review reflects comments and contributions by Richa Arya, Luciana Gallo, Lauren Gonzalez, Sam Lord, Dipika Mishra, Arthur Molines, Mugdha Sathe, Ryman Shoko, Ewa Maria Sitarska. Review synthesized by Ehssan Moglad.

      Study conducted by Chieh-Ren Hsia et al. which looked at nuclear deformation in confined migration and its effect in chromatin organization and function.

      Major comments

      Results ‘To distinguish between true changes in chromatin modifications and effects of physical compression of the nuclear content due to deformation, we normalized the heterochromatin mark intensity to the euchromatin mark intensity in each cell.’ - The results are normalized to H3K9ac, with the assumption that its levels do not change during migration/confinement. Has this assumption been confirmed? For example, by normalizing both H3K27me3 and H3K9ac to total H3 instead - and showing that K27me3 increases with confined migration while H3K9ac doesn't.

      Results ‘Increased heterochromatin formation should result in an increased ratio of heterochromatin marks to euchromatin marks, whereas physical compression of chromatin would increase both marks, and thus not alter their ratio…’ - Can some comments be provided on what the meaning would be for heterochromatin to "increase" and euchromatin to not change? There are two ways in which heterochromatin could "increase" - either the portion of the genome in heterochromatin could increase (which would mean the portion in euchromatin would decrease), or the portion of the genome in heterochromatin could stay the same but K27me3 levels could be higher in those regions (which might not affect euchromatin levels). One way to distinguish between these would be to stain for K36me3 as the "euchromatin" marker instead of K9ac - because K36me3 and K27me3 are mutually exclusive.

      Figure 1 <br /> - Could the effects seen be due to cells spending different amounts of time in the channels? Do all cells migrate at a similar speed? <br /> - Panels D, F, I: it is unclear if the cells shown in the plot for the change in heterochromatin marks are all that migrated or only those that show the difference. Suggest including a dot plot to also show individual data. Can some clarification be provided for how to interpret that controls "before" in 1D and 1F are statistically different?

      Counts in Fig S2A-D are sometimes very low (same applies to Fig 1I, Fig 2B,C,E.), it may be nice to compare some more cells.

      Results ‘Although the effect was less pronounced than in the ≤2×5 μm2 confined channels (Fig. 1C-F)’ - Can the normal size of these cells be reported ? Also the size of nuclei. is it bigger than the pore size?

      There are concerns about the statistical analysis related to SEM and p-values based on multiple measurements or cells within each sample. The t-test and ANOVA assume that each measurement is independent, and multiple cells within the same sample are not independent. Suggest to either not report p-values or average together the values from each sample and calculate the p-value using those sample-level means. For more information, see https://doi.org/10.1371/jou... and https://doi.org/10.1083/jcb...

      Minor comments

      Results ‘custom-made polydimethylsiloxane (PDMS) microfluidic devices with precisely defined constrictions that mimic interstitial space’ - The manuscript report the size of the channels, and notes that it mimics interstitial spaces, it would be helpful to also report the size range for interstitial spaces in vivo.

      Figure IH: Are these the same cells as in the reference (cells in which vertical confinement is sufficient to induce a nuclear response)? Are 5 um channels squeezing the nucleous?

      “significantly larger increase in heterochromatin than cells migrating through the 10-μm tall channels (Fig. 1H, I), demonstrating that the observed effect is primarily attributed to the confinement and not the migration process per se” - There is a statistical difference between the confined migration and non-confined migration groups, but there is also a statistically significant increase in heterochromatin in the non-confined migration group compared to baseline (and with larger sample sizes than in the confined group), so it may be worth commenting on the possibility of the effect of migration alone.

      “Cells maintained CMiH even after completing at least one round of mitosis, without any trend of reversion in their heterochromatin levels (Fig. 2C; Fig. S4A, B), suggesting that the epigenetic modifications were inheritable through DNA replications” - This is an intriguing concept, however, it is unclear whether the cells that migrated did so before or after dividing. To support the claim about inheriting CMiH, it would be relevant to see heterochromatin levels in a mother cell increase after it squeezes through a channel, then the daughter cell (which doesn't squeeze through a channel) having a higher heterochromatin level than the "before" cells. That's not possible with immunofluorescence, maybe the GFP-HP1a could be useful for such a live-imaging approach? Otherwise, if all these "mitotic cells" divided after squeezing through a channel, that could be stated in the text, legend, and/or methods. Alternatively, the conclusion could be nuanced/toned down.

      Figure 3 - The number of samples analyzed in some cases appears small. Suggest showing the data as dot plots to allow interpretation of the sample sizes for each group and the differences between the groups.

    1. On 2022-07-16 04:46:40, user Hui Zheng wrote:

      Little is known about whether and how Vitamin C specifically targets SARS-CoV-2 infection and its underlying molecular mechanisms, although some reports suggest that vitamin C may be beneficial in the treatment of SARS-CoV-2 infection. This study was finished through repeated verification with the help of many scientists. We sincerely hope that this easy and flexible strategy is useful to restrict the large-scale spread of SARS-CoV-2 in the population and to reduce the disease severity of COVID-19 in the early stage of SARS-CoV-2 infection.

    1. On 2022-07-14 15:54:12, user Qian Zhu wrote:

      I am author of the smfishHMRF package (part of Giotto) that is used in one of your comparisons in Figure 6. I am highly doubtful about the results your presented of Giotto in Figure 6 and same of SpaGCN. I believe much of the results you are seeing is due to the selection of genes to find spatial domains than having to do with the underlying method. We also do not rule out improper usage of our package in this comparison. We will share our findings with you in a separate thread.

    1. On 2022-07-14 06:25:43, user André Rendeiro wrote:

      Very interesting study. There is no methods section on the acquisition of microscopy images and quantification of nuclear features (Fig1c). Could the authors elaborate on how nuclear dispersion is measured?

    1. On 2022-07-13 22:14:10, user JKlumel wrote:

      1. Does the half-life of the fusion protein is expected to be 4-8 hours similar to YTI enhanced IgG bound to FcRn receptor?
      2. In classical situation FcRn orchestrates processing of IgG-opsonized immune complexes (IC) in concert with classical Fcγ receptors to present the antigenic peptides to APCs and ensure clearance of the IC. How the fusion protein opsonized immune complexes are going to be recognized by to APCs and cleared when the Fc is silenced? There will be no risk of neutrophil extracellular trap induced collateral damage resulting from excessive attempts to remove the Fc silenced IC?
      3. In studies with recombinant ACE2 it was shown that rACE2 in concentrations close to physiological range in plasma could enhance SC2 infection, while high concentrations achieved inhibitory effects on the infection. Is there a risk that nasally administered fusion protein shall get in plasma in physiological range?
      4. Is there a risk of IgG suppression in the mucosa of the upper respiratory tract due to FcRn binding to the fusion protein?
      5. Could the invention be financially competitive product in comparison to other nasal prophylactic agents: hypertonic saline, polysaccharides, povidone iodine, nitric oxide?
    1. On 2022-07-13 13:46:46, user Iratxe Puebla wrote:

      Review coordinated via ASAPbio’s crowd preprint review

      This review reflects comments and contributions by Oana Nicoleta Antonescu, Ruchika Bajaj, Sree Rama Chaitanya and Akihito Inoue. Review synthesized by Ruchika Bajaj.

      This study has characterized the function of Hero proteins in improving the recombinant expression of TAR DNA-binding protein in E. coli and restoration of enzymatic activity of firefly luciferase during heat and stress conditions. This study may be useful for future applications of Hero proteins in life sciences research. Please see below a few points offered as suggestions to help improve the study.

      • In introduction, 3rd paragraph, in context with “amino acid composition and length of Hero proteins”, please elaborate on the effect of these two factors on the function and stability of hero proteins.
      • The manuscript refers to “cis and trans” terms on several occassions. Please explain these terms in context with the association of Hero protein with the target proteins.
      • Introduction - A paragraph describing the origin of Hero proteins and the differences between the types of Hero proteins in the introduction section would be helpful for readers to understand the background on these proteins. For example, please explain the background on naming these proteins as Hero 7, 9, 11 etc. The genes SERF2, C9orf16, C19orf53, etc are mentioned in the plasmid construction section in the Material and methods. Please provide a brief explanation for the relationship between these genes and Hero proteins.

      • Please add more details in the Material and methods section, especifically in western blotting and the luciferase assay, to support the reproducibility of these experiments.

      • Figure 1A. Please explain the role of each component (for example factorXa) either in the text or the legend.
      • Figure 1B: Please add clarification regarding the normalization of lanes by total protein concentration.
      • Fig 1C. Please provide an explanation for the higher order bands in the western blot. The western blot using anti-FLAG antibodies shows non-specific bands. Alternative tags or antibodies or detection methods may be used, for example, GFP tag and in-gel fluorescence can be used to check the expression.
      • Figure 1D and 1E, the error bars are high. Suggest checking the data and providing the mathematical expressions used to calculate relative yields.
      • Figure 2D and E, the error bars are high, access to the raw data behind the graphs may aid interpretation. An explanation for the choice of temperatures 33 C and 37 C would be helpful. Is there any relation between the choice of temperature and the Tm of the protein? The protein is directly being treated at high temperature, similar experiments with cell-based assays would be helpful to understand the effect of the Hero proteins on the stability of Fluc. Would it be possible to report the mathematical expressions used to calculate “Remaining Fluc activity”. Recommend indicating n if these activities are calculated per mg of the protein. Please explain if the reduction in activity is due to loss of protein or loss of luminescence activity from each molecule of the protein.
      • Figure S1, access to the raw data would be helpful to understand the signal to noise ratio for activity.
      • Figure 2 and 3 show similar experiments with wild type and mutants, it may be possible to combine the figures (for example, to avoid the redundancy in Figure 2C and 3A).
      • Figure 3D and G, access to the raw data would be helpful to interpret the signal and noise ratio especially given the low values.
      • Figure 4, Can some further discussion be provided for the reason for higher residual activity for SM and DM than wild type? Tm experiments during stress conditions (heat shock and freeze thaw cycles) may be helpful to define the stability of Fluc and Fluc mutants.
      • Figure 5: Suggest including an explanation for choosing Proteinase K -among other proteases- for these experiments.
      • The residual activity is different in Figure 4 and 5, which could be due to different stress conditions. Please include some discussion about possible explanations.
      • In section “Hero proteins protect Fluc activity better in cis than in trans”, ‘When the molarity of recombinant GST, Hero9, and Hero11 proteins was increased by 10-fold...’ does molarity refer to the concentration of protein ?
      • In the first paragraph of the discussion, “physical shield that prevents collisions of molecules leading to denaturation” and “maintaining the proper folding” is mentioned. Is it the hypothesis for the mechanism behind the stability provided by Hero proteins? Can further discussion on this be provided, along with a relevant reference.
      • In the discussion section, it is mentioned that “Hero may be reminiscent of polyethylene glycol (PEG)”. Please provide further explanation for why hero proteins are correlated with PEG in this fragment.
      • A discussion on why specific Hero proteins may be better for specific target proteins may be helpful.
      • In the second paragraph, of the Discussion “Hero protein can behave differently depending on the client protein and condition” and “important to test multiple Hero proteins to identify one that best protects the protein of interest” are mentioned. Suggest adding further discussion of these points, for example around any alternatives or computational predictions or simulations to test individual Hero proteins for specific client proteins.
    1. On 2022-07-12 20:32:14, user Xing Jian wrote:

      It is not clear to me which “case” patient sample from the Coriell Institute was used, and where the whole-exome sequencing data was obtained. These information should be presented in the published version.

    1. On 2022-07-10 17:36:37, user Ashraya Ravikumar wrote:

      Summary:

      In this paper, the authors address the important question of how Aminoacyl-tRNA synthetases (AARSs) have evolved. A key attribute of AARSs is that they have specialized to transfer specific amino acids to their cognate tRNAs, with minimal cross-reactivity. Although there are two major classes of AARSs (Class I and II), they focus specifically on Class I AARSs (since they could not perform a stable phylogenetic analysis on Class II). To this end, they have employed structure based sequence alignment of HUP domains of different Class I AARSs, based on which they built phylogenetic trees and performed ancestral sequence reconstruction. They make interesting, but counterintuitive, observations on the evolutionary trajectory of AARSs in comparison to the timeline of emergence of amino acids themselves. Specifically, they note that AARSs which charge amino acids that emerged later in time appear as early branches in the phylogenetic tree and vice versa. They also observe that one of the AARS ancestor (Anc-all-minus) had a wide substrate binding pocket that did not confer amino acid sidechain selectivity, but rather selected for L-configuration ɑ-amino acids. Based on these results, the authors propose a new model of evolution of Class I AARSs called generalist-maintaining (GM), where the early ancestor with non-specific/generalist activity is maintained and as amino acids emerged later in time, became starting point for the evolution of specialized AARSs. Overall, the paper is concise and self-sufficient. The conclusions drawn by the authors are significant and well supported by data. There are a few minor points that we want to bring to the attention of authors, which could improve the manuscript further.

      Minor points:

      The authors discuss one set of ancestral reconstruction throughout the paper. Were there any alternatives generated by the software used? If yes, on what basis was this particular reconstruction chosen? Perhaps, if there are alternatives, the authors could build the ancestry based on them and see if it yields similar results. If it does, it could make the conclusions from this paper more robust.<br /> The authors mention in a single sentence in Methods - “Ancestral states were inferred using codeml from the PAML package”. Since this is one of the most important steps in this work, some explanation about how this was done and any parameter choices or tuning can be useful.<br /> On Page 7, they say “The anticodon binding domains are thought to have emerged later, in agreement with our analysis, which indicated that the anticodon domains of Class I AARSs relate to at least three separate evolutionary emergences (Table S1)”. The three emergences of anticodon domains is not clear from Table S1. If we are to go by the different H groups according to ECOD, there are only two in the anticodon binding domain column in Table S1. Some clarity on this will be helpful<br /> Since the authors frequently compare the specialization of AARSs with the emergence of amino acids, a schematic showing the order of appearance of amino acids will be more illustrative than making the readers refer to multiple papers. Potentially using real amino acids in Figure 4 would be more clarifying than A,B,C,D,E?<br /> The phylogenetic trees shown in Figure S4 are key to this work. The authors could make the Raxml tree (since this was used for ancestral reconstruction) a main figure to guide the reader about this important part of the paper.<br /> The expansions of many abbreviations used throughout the paper haven’t been given (for example - HUP, HIGH, ECOD)<br /> The importance of outgroups in ancestral reconstruction is remarked upon twice “due to the lack of a suitable outgroup, making ancestor reconstruction intractable.”... “Using Clade 2 as an outgroup, we succeed in the construction” - but would benefit from a sentence or two (and reference) explaining this necessity to readers from non-phylogenetic backgrounds.<br /> The discussion of the structural/functional characteristics of the inferred ancestors could be expanded. For example: “Further, the inferred Anc-All-minus pocket bears no hallmarks of a Val activating enzyme,” it is unclear which hallmarks you are referring to and what is different in the ancestor. Predicted AlphaFold2 structures of the ancestors might help here, especially aligned with substrate bound/docked structures of extant AARSs.

      Ashraya Ravikumar and James Fraser (UCSF)

      James Fraser had a long scientific relationship and personal friendship with the late Dan Tawfik and objectivity (which is always something in the eye of the beholder) may be particularly impacted here.

    1. On 2022-07-10 01:25:17, user Charles Warden wrote:

      Hi,

      Thank you very much for posting this preprint.

      I think this provides a number of useful references and comparisons.

      I also have a few comments:

      1) While rMATS and MISO are popular programs, I don't think they are necessarily my preferred starting point for splicing analysis.

      For example, I might consider the following as starting points for splicing analysis:

      a) QoRTS + JunctionSeq (an extension of DEXSeq with a separate dispersion estimate for junctions versus exons)<br /> b) Custom analysis of the tab-delimited splice junction counts (SJ.out.tab) from STAR.

      Perhaps b) is too open-ended. However, if you labeled the junctions like genes or transcripts, you could calculate Count-Per-Million (CPM) values and perhaps use traditional differential expression methods (DESeq2, edgeR, limma-voom, etc.).

      Unlike a), there would not really be specialized splicing visualization for b) without additional coding.

      However, both of these strategies do not fit the description of "alternative splicing events (ASEs) are conceptualized as binary choices". Instead, each junction is treated like a feature.

      So, I can see how that can complicate comparisons. Nevertheless, limma-voom and DESeq2 are used as part of this package. If I look at the ASE-methods.R code and the supplemental methods, I think the main difference is the "Treatment:Isoform" interaction variable.

      In other words, if you had 2 groups with 3 replicates and 2 junctions as part of splicing event, am I understanding the that the difference between SpliceWiz and what I would have otherwise expected is that you now have 12 count measurements (2 junctions) instead of 6 count measurements (1 junction)?

      So, if I am understanding everything, I am not sure if you have comments with respect to why a strategy more like JunctionSeq (or what I might write with custom code for individual junctions) is not preferable and not provided as an option within SpliceWiz?

      2) I thought Figure S4 was interesting and useful.

      However, the retained intron counts are quite different, as also mentioned in the text: "Of the 15,188 extra retained introns annotated by SpliceWiz, 15,144 (99.7%) of these would have been excluded due to this extra criterion."

      Identifying additional differential intron retention events might be helpful, but I also wonder if perhaps this also corresponds to additional false positives. For example, I am also not sure how often there might be pre-mRNA and/or pseudogenes where no introns are spliced (not a single retained intron event). For example, if there are confounding factors not sufficiently modeled in simulated data, then I would expect estimates of accuracy could be considerably different than in actual data.

      3) As a minor point, there is a typo in the description for Figure 5: "Heirarachical" instead of "Hierarchical".

      Thanks Again,<br /> Charles

    1. On 2022-07-09 18:08:54, user Brian Stevenson wrote:

      Please note that observation of punctate patterns of DNA in Borrelia burgdorferi has been published before. Similar patterning was also observed in relapsing fever Borrelia. The pattern observed here should not have been a "surprise" (line 100).

      References that should be cited are:

      Jutras et al., 2012, EbfC (YbaB) is a new type of bacterial nucleoid-associated protein and a global regulator of gene expression in the Lyme disease spirochete, J. Bacteriol 194:3395-3406,<br /> pubmed.ncbi.nlm.nih.gov/225...

      Kitten and Barbour, 1992, <br /> The relapsing fever agent Borrelia hermsii has multiple copies of its chromosome and linear plasmids, Genetics 132:311-324, <br /> pubmed.ncbi.nlm.nih.gov/142...<br /> (this paper is currently cited for a different reason)

    1. On 2022-07-08 10:20:41, user Kees Jalink wrote:

      Please note that this work has in the mean time been published in largely unaltered form in Scientific Reports, 2021 Oct 20;11(1):20711; DOI: 10.1038/s41598-021-00098-9.

      For clarity, we also share the reviewer comments and our responses to that with you:

      Reviewer Comments:

      Reviewer 1<br /> This is a very elaborate and interesting study proposing a dynamic genetic screen based on FRET-FLIM and which allows for a more refined understanding of the impact of gene knockouts on cellular signaling and metabolic processes compared to the simple cell viability and colony formation readouts widely used in the past (and also currently). The authors used an innovative FRET-FLIM sensor (created by them) expressed in stable cell lines to monitor changes in the levels of cyclic AMP by modulating phosphodiesterase-induced breakdown via treatment with silencing RNA (siRNA) oligonucleotides.

      I only have a few comments regarding the text of the article, as follows.

      1. It is very difficult to understand from the abstract the purpose of the paper, at least from the standpoint of the general FRET enthusiast with no specific knowledge regarding the biological application described. (i) Specifically, in the second paragraph, the agonist of what receptor are the authors referring to? What is the connection between the” 22 different phosphodiesterases (PDEs)” and the baseline levels of cAMP. Is that what the sentence refers to? It is hard to guess from the current sentence structure.<br /> (ii) The authors used “HeLa cells stably expressing our FRET-FLIM sensor.” Precisely what sensor does “our” stand for? (iii) The rest of the paragraph does not seem much easier either, especially given the numerous undefined acronyms. All these questions are fully addressed in the body of the paper, though not in the abstract.<br /> The last 75% of the abstract has been completely rephrased to address hopefully all of the reviewers concerns. Changed part is indicated with track-changes.

      2. On page 3, the authors state: “FLIM is a robust and inherently quantitative method for FRET detection which requires no additional calibrations or correction parameters.” That is not entirely correct, for a couple of reasons: (i) FLIM generally requires separate knowledge of the donor lifetime in the absence of FRET. <br /> The reviewer is right. We condensed the text so much that we cut some corners. We have now rephrased that claim, and mentioned that the donor lifetime is a necessary calibration. See page 3.

      (ii) One has to fully separate the donor emission from acceptor emission, which is usually done achieved band-pass filters (it is also done, though not very often, using spectral resolution). This is not unlike what is done in intensity-based measurements, in which, at least one is attempting to unmix the donor and acceptor signals or at least apply some post-measurement corrections for bleed through (caused by spectral overlap between donor and acceptor emission). The fact that FLIM researchers often choose to ignore this kind of corrections may not be interpreted, in my view, as an advantage of FLIM. Please consider adjusting the text.<br /> We could not agree more! In particular in view of our own contributions to obtain truly quantitative sensitized emission FRET (van Rheenen et al, BJ 2004), we are keenly aware of the dangers of spectral overlap. That is the reason that in this study we used our Epac-SH189 FRET sensor which has dark (i.e. non-emitting; Y145W mutation; Klarenbeek et al, PLoSOne 2015 ) acceptors. Given the high QY of the donor, the lifetime of this sensor has ignorable contribution of acceptor emission even if a large spectral window is selected. We did not attempt unmixing approaches, because our pilots had indicated near-identical lifetimes when the emission was taken just from the part of the spectrum that is exclusively occupied by mTurquoise. This information is presented towards the end of the introduction on page 5, in the paragraph where we present a more specific outlook to the contents. It has been rephrased in part for better emphasis.

      1. The results shown in Figures 6 and 7 are fascinating. To let the reader more easily follow the story, could the authors insert “agonist” or “antagonist” as necessary within the following sentences? “We first stimulated HeLa cells with 40 nM isoproterenol which caused a rapid rise in cAMP levels and subsequently added propranolol at 60 nM concentration which caused a sharp decline following the stimulation. Finally, 25 µM forskolin…”<br /> We have adapted the text (page 14) and legend of figure legends (page 15) according to these suggestions.

      Once again, in my evaluation, this is an excellent, detailed, and rich in information study worthy of publication in a high caliber journal.

      Reviewer 2<br /> The manuscript submitted by Harkes et al. on the topic of FRET-FLIM HCS with siRNA screen to monitor dynamically the change of cAMP concentration using a FRET biosensor is well written with interesting results and shows the high potential of this method. In order to increase its impact and for clarification I have few queries:<br /> [1] I found the introduction of interest but previous work in the scope of HCS FLIM is missing. I suggest to add references of several groups working in this direction (French, Tramier, Esposito...).<br /> In our introduction we sought to emphasize work that is geared towards screening of fast dynamic changes in lifetime in living cells, which implies imaging with very high photon fluxes and with methods that do not waste photons unnecessarily, so as to avoid unnecessary cell damage. We agree with the reviewer that this does not acknowledge much of the work of those who contributed to high-content and high-speed FLIM imaging, in particular from pioneers like Drs French, Tramier, Esposito, but also e.g. Gerritsen, Ameer-Beg and others. We have now rewritten that part (page 4) and added 4 references to just a few of the very relevant contributions.

      [2] For lifetime analysis, authors have used biexponential fit with two fixed lifetimes 3.4 and 0.6 ns with a final determination of mean lifetime using the different preexpo factors. I'm not sure that this approach is the more appropriate. First, what means these two fixed lifetimes? is it pertinent with the biosensor under study? this is not really discussed in the manuscript.<br /> Second, if finally you use a mean parameter for the concentration curve fitting, why not using a mean analysis such as the mean arrival time? This parameter is now directly calculated in the FALCON version and seems pertinent because HyD have very low noise. From my point of view, this will increase the sensitivity and the speed of the measurement. In any case, this has to be discussed.<br /> In fact, we had given this quite a bit of thought but for brevity, it did not make it to the final draft. In brief, we performed 2-component fits because these fitted much better than single-component fits. The lifetimes of 3.4 and 0.6 ns were selected because these were the dominant components in large numbers of global (i.e. whole-image) fits. We expected a dominant component of 3.4 ns, which is that of the Epac sensor in its low-FRET configuration. The low lifetime, 0.6 ns, is in fact significantly below the resting-state lifetime of the cells (minimally 1.9 ns in some cells) but it is the second dominant Tau in the two component fits and the phasor analysis also indicates a intercept below 1 ns. Our data were thus collected and exported (data reduction) for those two components, enabling us to analyze both effects on long as well as on short lifetime contributions upon PDE knockdown.<br /> In preparing figures for the manuscript, we noted no clear advantage of separately presenting data of both lifetimes and their amplitudes, so we decided to extract the weighted mean lifetime. This has now been described more completely in the Methods section (page 6). For the reviewer, we also note that we are not fond of using the FALCONs mean photon arrival time because 1st, unlike the fitting, it proved to be quite sensitive to environmental (background) light, and 2nd, there is a small bug in our version of the software which sometimes causes erroneously high lifetimes when recalculating old data with the ‘mean photon arrival time’ option. 3rd, this method has the same number of free fit parameters as a single component fit. We experienced that the result with this method had less pixel to pixel variation compared to a single component fit.

      [3] When showing screen results, only fitting parameters are presented in figures. Is it too difficult to present few curves in which differences can be shown? This will increase the understanding of the reader before to present the statistics.<br /> We thank the reviewer for this excellent suggestion. Two panels have now been added to the boxplot in Fig. 4

      [4] From my point of view, details regarding how to add drugs in multi-well plate has to be presented. Is it pipeting ? and in this case it does not really make High Content automated approach. Moreover, how is managed the focus since probably you loose it during pipeting... or is it more automated device that you use in the context of multiwell plate. In addition, how is selected the FOV? how to manage the human choice? This has to be detailled and discussed.<br /> We have extended the text in Materials and Methods to cover all of these aspects, see page 6, 7. In brief, in this study we present only data from studies where stimulus addition and mixing where done manually, although we have also implemented automated addition of stimuli (3 channels). For the protocol involving rapid sequential agonist-antagonist stimulation we found that, at least with our equipment, automated addition of stimuli depended too much on diffusion, and therefore results were more variable than with manual mixing. For keeping in focus, we routinely used the Leica hardware focusing option, AFC.

      One last important issue: in revising our manuscript, we noted that the reported sequences for siRNAs used for PDE8A accidentally had become mixed up. We now corrected those entries in Supplementary Table S1. This correction does not affect any of the experiments, microscopy data or interpretations whatsoever, it solely affects one row in that table. <br /> We expect that with those changes, we have adequately addressed all issues raised by the reviewers. We feel that the manuscript has significantly improved in the review process and we are indebted to both reviewers for their time and thoughtful comments.

      Sincerely, on behalf of all authors, <br /> Kees Jalink

    1. On 2022-07-07 16:03:17, user Kathrin Liszt wrote:

      Hi,<br /> in your methods at "Affinity based Cas9-Mediated Enrichment" you describe to collect the supernatant which must have around 740 µL volume that includes your DNA sample that need to be washed then with the Ampure XP beads. How much beads did you add for that wash. How did you do the wash with the Ampure XP beads?<br /> Regards,<br /> Kathrin

    1. On 2022-07-07 10:16:54, user Prof. T. K. Wood wrote:

      Congratulations. Never was any credible evidence that anti-phage systems like toxin/antitoxin and CBASS systems, etc. kill cells; just wild claims without evidence. Note the the first TA system found to inhibit phage by transcription shutoff should be cited (Hok/Sok, https://journals.asm.org/do... ) since it was discovered 25 years before ToxIN.

    1. On 2022-07-06 17:55:48, user Iratxe Puebla wrote:

      Review coordinated via ASAPbio’s crowd preprint review

      This review reflects comments and contributions by Ruchika Bajaj, Sree Rama Chaitanya Sridhara and Wei Chen. Review synthesized by Bianca Melo Trovò.

      Genetic transcription happens through individual Transcription Factors (TFs) whose binding events can, in some systems, temporally correlate with the stochastic firing of transcriptional bursts. The determinant of bursting is however unclear, specially whether the DNA binding kinetics solely contributes to that. The study develops an imaging-based synthetic recruitment assay called CRISPRburst in order to measure the TFs impact on bursting kinetics. The authors find that the association of TFs with specific protein partners determines their bursting output, and train a model to predict the kinetic signatures of all human TFs.

      Major comments

      The manuscript reports that “the maximal intensity per transcription site (TS) is likely limited by physical constraints of the transcription machinery as a limited number of RNA polymerase molecules can be loaded per gene due to polymerase velocity and spacing”. It is recommended to describe how this limitation correlates with the value of active fraction, or could be part of further analysis of this functional data.

      ‘Functional characterization of TFs using an imaging-based synthetic recruitment assay’ section: “If the frequency and duration of active periods were solely defined by TF binding” [...] “TFs recruited via dCas9 would all exhibit similar active fractions”. This prediction appears to rely on the assumption that the binding rate is the same for all TFs, which is usually not the case.

      ‘Functional characterization of TFs using an imaging-based synthetic recruitment assay’ section: Given that the TFs that do not bind to the LTR also show high correlation, it is unclear how the correlation for the 6 factors that directly bind LTR justifies that dCas9 recruits TFs in a similar way to the physiological conditions. What is the explanation for the high correlation coefficient for the TFs that do not bind LTR? There is a question as to whether the dCas9 system represents the physiological conditions because the DNA binding kinetics for each TFs are distinct, and different from that for PYL1 binding to ABI1. It would be expected that those different DNA-binding kinetics also contribute to the frequency, duration, or intensity of bursting. Some clarification could be provided around this point.

      ‘Interactions with co-activators are more predictive of TF kinetic specificity than IDR features’ section “This model was unable to classify TFs into kinetic classes (Figure 3B, right), demonstrating that TF-cofactor interactions play a greater role in specifying kinetic function than IDR sequence content”: Given that TFs interact with cofactors through their transactivation domains, which are intrinsically disordered, why do the TF-cofactor interactions not lead to correlation between IDRs and the kinetic function? Could the protein-protein interactions besides IDR-cofactor (e.g. cofactor-cofactor interactions) play a role in the kinetic function? Do the cofactors cluster into the different kinetic function groups?

      Minor comments

      Introduction ‘differ in features typically used to classify TFs, such as DNA binding domain homology’: it may be worth making a mention in the introduction to what other binding partners TFs interact with.

      First paragraph of results ‘CRISPRburst, an inducible dCas9-mediated recruitment platform to study transcription kinetics’: What is the binding strength of PYL1 to ABI1? How does that compare to the typical TF-DNA binding strength?

      Figure 1C: “3) Live cells are imaged 16 h post-recruitment.” This is the end time point. Are there time-dependent data available?

      Figure 1 F, G: The error bars are high. Can further information be provided in the legend on how these error bars were calculated (biological vs technical replicates)?

      Figure 1, ‘An average of 220 cells were analyzed per TF’ Does this imply that 220 transcription sites were scored? Considering each imaged cell has single integration of the reporter gene?

      ‘In total, the LTR-MS2 cell line stably expresses 1) the LTR-MBS reporter gene’: Is there information on where in the genome the reporter gene is integrated? And does it impact the transcription bursts? (considering the role of (epi)genetics in the transcriptional outcome as rightly reinforced by the data related to Fig.4).

      Functional characterization of TFs using an imaging-based synthetic recruitment assay: Please provide a description for the Krüppel associated box.

      “Upon recruitment, 28 TFs generate an increase in reporter active fraction”. It would be helpful to provide further clarification on how the reporter active fraction is defined and how the criteria "ratio > 1.30" was determined. A mathematical equation may also aid the description.

      ‘0.64 to 3.04 for active fraction and 0.68 to 1.64 for intensity (Figure 1F-G, S1E) ‘: It may be helpful to divide the active fraction (0.64 to 3.04) into different categories, for example, 3.04 - 2.5, 2.5-2.0 etc. to check whether these categories are correlated to function.

      Regarding intrinsically disordered regions (IDRs) in the Results section ‘Bursting kinetics define distinct TF classes’: Can further clarification be provided in the main text for the meaning of cumulatively longer IDRs.

      “these findings suggest that while the biophysical properties of IDRs may tune the amplitude of TFs’ effects, they likely do not solely encode TF kinetic specialization”: does this include post-translational modifications? If so, are there any relevant examples or illustrations?

      In the section ‘TF families exhibit broad kinetic diversity’ section, “the family-defining KRAB domain does not bind DNA but recruits cofactors, consistent with the idea that DNA binding domains provide little information on kinetic specialization (Figure S6B)”. It may be relevant to discuss potential solutions to these issues in the Discussion section.

      Discussion section “Our study centered on the simple HIV promoter thus provides a robust conceptual framework to investigate more complex systems, e.g. how TFs synergize with one another, interact with core promoter motifs, or communicate to promoters from distal enhancers”: all the future directions mentioned here are very relevant and exciting. Could the discussion of these items be expanded e.g., how do developmental cues drive TF kinetics or bursts?

      Methods section: Are there any anomalies observed in the subcellular localization of the TFs when tagged with PYL1 or under the ABA treatment?

      Comments on reporting

      The manuscript reports a partial least-squares multivariate regression model in which a predictive weight to each possible interactor was assigned. Can further description and a related equation be provided for this model?

      Fig. 3: Can further context be provided for the choice of SEM instead of SD which may provide a better representation of data variability?

    1. On 2022-07-05 22:26:50, user Prof. T. K. Wood wrote:

      Would be great to see the supplemental information. Also, would be interesting to quantify the 100S fraction over time.

    1. On 2022-07-05 13:23:20, user Jianfeng Lee wrote:

      This work was officially published in Brilifling in bioinformatics:

      Jianfeng Li, Benben Miao, Shixiang Wang, Wei Dong, Houshi Xu, Chenchen Si, Wei Wang, Songqi Duan, Jiacheng Lou, Zhiwei Bao, Hailuan Zeng, Zengzeng Yang, Wenyan Cheng, Fei Zhao, Jianming Zeng, Xue-Song Liu, Renxie Wu, Yang Shen, Zhu Chen, Saijuan Chen, Mingjie Wang, Hiplot Consortium, Hiplot: a comprehensive and easy-to-use web service for boosting publication-ready biomedical data visualization, Briefings in Bioinformatics, 2022;, bbac261, https://doi.org/10.1093/bib...

    1. On 2022-07-02 08:02:09, user Aram P. wrote:

      Hi all. Thanks for Your work. I want to mention two possible errors in Your paper.<br /> 1. The paper say that Late Armenia cluster do have a partial continuity with Early Armenia cluster. The estimated proportion is 50%. That's looks good. But the other 50% can't be from Steppe as You state. Because Late Armenia cluster is shifted to Near East. So it's more likely that the extra 50% is from South not from Steppe <br /> 2. The other issue I see is the place of modern Kurdish samples on the PCA. Near Lybians.

      Thanks in advance for Your attention.

    2. On 2022-06-07 03:30:39, user Sean Dugaw wrote:

      I share Davidski’s criticisms regarding the geographic labels. In addition, I would add that Egypt is not ever considered part of the Levant. I understand why you have grouped the populations of Egypt and the Levant together, however a label which includes both terms seems called for.

    3. On 2022-05-19 13:21:33, user R. Rocca wrote:

      Authors, the labels in the ENA Browser completely mismatch the BAM files. For example, the row with the label ID R11563 has a link to 1554.bam. Most, if not all the labels are wrong. If they are used for future research, there will no doubt create a lot of erroneous results.

    4. On 2022-05-18 22:14:12, user Davidski wrote:

      Hello authors,

      Unfortunately, there are some serious problems with the geographic concepts in your preprint:

      • your Steppe region includes a large swath of Eastern Europe that is mostly forest and forest steppe. Only about a third or less of this region is actually a steppe (the Pontic-Caspian steppe). Calling this region Eastern Europe would be more useful and in tune with geographic conventions.

      • what you call Eastern Europe is not generally, by itself, known as Eastern Europe, especially since the fall of the Iron Curtain. That is, Czechia, Hungary and Slovakia (often along with Poland) are nowadays more commonly described as East Central Europe.

      • what you call SE Central Europe is actually much of the Balkans, and thus straight up Southeastern Europe.

      Honestly, calling Bulgaria Central Europe, while, at the same time, calling Czechia (inc. Bohemia) Eastern Europe just doesn't look right.

    1. On 2022-07-01 10:23:35, user Iratxe Puebla wrote:

      Review coordinated via ASAPbio’s crowd preprint review

      This review reflects comments and contributions by Ruchika Bajaj, Bobby Hollingsworth, Gary McDowell and Michael Robicheaux. Review synthesized by Michael Robicheaux.

      The preprint manuscript by Trendel et al., “Translational Activity Controls Ribophagic Flux and Turnover of Distinct Ribosome Pools”, presents a dataset that examines the lifecycle of human ribosomes, and their constituent subunit proteins, in response to translational inhibition using proteomics and cryo-EM approaches. The study focuses on the fate of 80S monosomes, which are shown to be inactive and to form a dynamic pool separate from active polysomes and nascent ribosomal subunits.

      General comments

      • The manuscript is well-written and organized, and the methodology is thorough and detailed.

      • The effort to validate mass spectrometry quantitative measurements, particularly the peptide sum normalization (PSN), is commendable. The description of total sum normalization and its weaknesses in this methodology is well articulated. This work will be useful for others working on similar problems in quantitative mass spectrometry.

      • The described pulse-SILAC methods are quite successful at monitoring protein stability in response to different perturbations; however, the statements in favor of ribosome subunit decay through ribophagy/selective autophagy require further support. Since ribosome component decay can be due to a variety of additional pathways (see cited reference #17, An et al., 2020), it may be necessary to soften the conclusions regarding ribophagy. Additional pulse-SILAC experiments in cell lines that lack key autophagy components (e.g., ATG12/FIP200 KO cells) could be considered to directly test the ribophagy model.

      • There are questions as to whether the cryo-EM processing supports the conclusions stated in the manuscript. Specific comments regarding this are provided below. In addition, additional processing detail in the flowcharts presented within the supplemental data would be helpful to better understand processing choices (e.g., D classes that move forward for additional analysis/classification/refinement).

      • It would be relevant to discuss how the proteomic half-life measurements compare to those published by Li et al. 2021 (Mol Cell), which use a different method (cyclohexamide chase).

      • The manuscript reports significant differences in the half-lives of the 40S/60S ribosomal subunits vs 80S/polysome fractions (Fig 1E), and states that these make up separate ribosomal pools without free exchange. However, it should be considered as an alternative that the decay rate of assembled ribosomes could be much less than the unassembled group so that the pool of free components becomes gradually depleted. In this case, exchange could still occur with a decreasing rate as the pool of free ribosome proteins are degraded faster than assembled ones. It would also be relevant to discuss the possibility that nascent 40S and 60S subunits form 80S monosomes in an alternative “life cycle” pathway.

      Specific comments and suggestions

      • In paragraph 1 of the Introduction, please specify the context of “serum withdrawal” as the stimulus for idle 80S ribosome accumulation. Is this from cell culture or some other system?

      • In paragraph 1 of the Introduction, the sentence, “Degradation of ribosomal complexes, especially under nutrient-poor conditions, is mediated by ribophagy, a selective form of autophagy [14–17]” could be more nuanced as it does not describe other non-autophagic ribosomal degradation pathways, such as those described in cited reference #17 (An et al., 2020).

      • In the “A Highly Robust Normalization Procedure...” Results section, the manuscript states that the intensive ribosomal purification methods lead to high variability in the mass spectrometry measurements. Based on this, have alternative methodologies been considered for ribosome purification?

      • In panel E of Figure 1, the color scheme makes the data difficult to differentiate, could also consider separate figures for the large and small subunit datasets.

      • In the “Protein Half-Lives in Polysome Profiling Fractions...'' Results section, “On average ribosomal proteins of the small subunit had 3-fold longer half-lives within the 80S fraction compared to the 40S fraction (p=5.2E-8, Wilcoxon ranksum test), whereas large subunit proteins had 4.6-fold longer half-lives within the 60S fraction compared to the 80S fraction (p=1.0E-10).” Are the “60S” and “80S” fractions mixed up at the end of the sentence?

      -In the “The Monosome Fraction Predominantly Contains Inactive 80S Ribosomes...” Results section, the manuscript reports, based on their cryo-EM data (Fig. 2), that 80S monosomal complexes are idle and distinct from polysomal 80S complexes. This conclusion of a single ribosome state would need supportive evidence. From the initial particle stack (>1 million) that yielded <60k high-resolution particles after classification: were there other low-resolution class averages or heterogeneous particles that may represent actively translating ribosomes? Conclusions about ribosome activity from less than 5% of the total pool of ribosomes could be due to the conformational plasticity of translating ribosomes. In a different paper (Brown et al., eLife. 2018), several structures/states of the ribosome come out of a smaller dataset. Furthermore, a structure of comparable resolution from the polysome fraction appears necessary to support the conclusion that the 80s monosome complex is functionally distinct. The same comparative data is recommended for conclusions drawn from the cryo-EM structural analysis of arsenite treated 80S particles (Fig .S6).

      • In the “The Monosome Fraction Predominantly Contains Inactive 80S Ribosomes..” Results section, this section introduces ribosomal P-stalk proteins, their plasticity and role in active ribosomes, which are concepts that could be included in the Introduction section of the manuscript.

      • In Figure 2, it is unclear from the figure legend if the 80s monosome density in panel B is from the low-salt treated preparation in panel A or from a different prep.

      • In the “Inhibition of Translation Produces Inactive 80S Ribosomes...” Results section, recommend revising the text to reframe the conclusion as "supports our model".

      In the “An Increased Pool of Inactive 80S Ribosomes..” Results section, recommend toning down the claims about decay rates which may require control experiments in cells lacking key autophagy proteins, such as ATG12.

      • In the “An Increased Pool of Inactive 80S Ribosomes...” Results section, consider reframing the conclusions from the previous study (Trendel et al. 2019) to indicate that ribophagy is the predominant mechanism of ribosomal protein turnover in response to arsenite treatment. The prior study did not examine ribosomes treated with arsenite when autophagy was blocked. Additional quantitative tests for flux into lysosomes (Lyso-IP, Ribo-Keima shift assay) should be considered to support that ribophagic flux, specifically, eliminates proteins from ribosomal pools. Based on this comment, the inclusion of ribophagy in Fig. 5 and the statements in the final paragraph of the Discussion may require revision.

      • In the “An Increased Pool of Inactive 80S Ribosomes...” Results section, the manuscript describes proteomic data in response to increasing concentrations of arsenite. The effects of these treatments on polysome profiles could be useful future experiments.

      • In the “Constrained Conformational Plasticity...” Results section, there are questions about this analysis due to the small size of the final particle stack for both proteins. An alternative analysis pipeline is to mix the particles from both datasets for the simultaneous analysis of all pooled particles, from which the number of particles in a given state can be quantified.

      • In the “Distinct Pools of Ribosomal Subunits...” Discussion section, the discussion of inactive 80S complexes potentially re-entering the polysome “assembly line” is quite interesting to consider in terms of its dynamics and follow-up experiments that would test this theory (including subcellular localization).

      In the “Distinct Pools of Ribosomal Subunits...” Discussion section, the manuscript posits that the degradation of newly synthesized ribosomal subunits is not energetically favorable; however, it should be considered that intrinsically disordered proteins, such as transcription factors, can be produced and quickly degraded in oscillatory patterns (e.g. see https://pubmed.ncbi.nlm.nih.... A quality control pathway that would eliminate immature or nascent ribosomal subunits is conceivable.

      • Consider depositing all EM data in EMPIAR and relevant structures in EMDB/PDB, and depositing the mass spectrometry raw data in ProteomeXchange or similar database. A data availability statement could be added with relevant accession links and IDs.

      • It would be helpful to build a tool to browse protein-level half lives and re-analyze raw data (e.g., tidy script depositing in Github or similar).

    1. On 2022-07-01 02:26:15, user Sciency wrote:

      This is spectacular work. I have a feeling I'll be referencing it a bunch. I have two small questions.<br /> - You used the Reef Life Survey Database, and for each sampling location, one of the parameters was whether that location is within 10km of a reef? I'm not yet familiar with the database, but it sounds like it covers more than reefs and reef-adjacent areas? (assuming anything further than 10km wouldn't count as reef-adjacent)

      • I'm not super-sure the phrasing of "hypothesize that MPAs counterbalance (mediate) the effect of coral reefs, human density, and thermal stress on species richness" is fully clear. In the diagram, I see that a coral reef increases species richness by 54% if the reef is within an MPA, and by only 15% if the reef is not in an MPA. So, to me, this would not be MPAs "mediating" the effects of the reefs. Maybe enhancing or supporting? Mediating usually has the connotation of making a negative effect less negative or a positive effect less positive, no?

      Thanks for the paper. Beautiful work.

    1. On 2022-06-30 18:01:00, user QuiPrimusAbOris wrote:

      Interesting piece of work substantiating the role of CAFs in tumorigenesis with some specific mechanism. The authors emphasize here the obvious TRANS effect (Fibroblast --> Epithelium). But the key question alas remains not answered: What makes the BRCA1 mutated epithelial cell convert the normal fibroblasts into (pre)CAFs? Can wildtype fibroblasts also become, with same ease, tumor promoting CAFs in this model?<br /> it shold be reminded that with germline BRCA1 mutation we have the rater unusual but interesting setting of having an oncogenic mutation in both the epithelium and stroma. <br /> The more usual setting is to have the mutated epithelium be surrounded by genetically wildtype fibroblasts - which still are converted into CAFs.<br /> This aspect is not addressed, not even discussed. It is also not clear what the authors mean by "control" when they say it since they do not specify it (there are many questions in this regard): BRCA1 wildtype cells from cancer-free healthy individuals or from precancerous, non-BRCA1 tissues.. Would be nice to have both types f controls. etc. Also the genotype of the fibroblasts with respect to BRCA shold be specified in every experiment.

    1. On 2022-06-30 16:17:06, user Arianna Basile wrote:

      Hello :) Very interesting, thank you for this tool and best luck for its publication. May I ask if you are planning to release the code on a public GitHub page?

      Best,<br /> Arianna

    1. On 2022-06-30 05:39:56, user NATTASIT PRAPHAWI wrote:

      Hi, you have done a great work! <br /> 1) I noticed that you might need a correction on Fig.7 <br /> "Fig.7 Chromatin condensation promotes ~~osteogenesis~~ adipogenesis of hMSCs cultured on soft hydrogel"<br /> 2) It would be great if hMSCs cultured on stiff hydrogel were included as a control in every experiment.<br /> Best,

    1. On 2022-06-29 20:42:56, user Charles Warden wrote:

      Hi,

      Thank you very much for posting this preprint. I think this is an interesting manuscript.

      At the moment, I have one question:

      Is there a reason why there is not a plot for Asian ancestry in Figure 3?

      I see mention of "East Asian" populations in the ADMIXTURE analysis section of the methods, and I also see a plot similar to what I might expect in Supplementary Figure 11. It looks like the East Asian contribution is usually small, but the African contribution in Figure 3 is also often small.

      I mention this because there was a paper reporting mixed Native American ancestry for the MDA-MB-468 cell line (from Hooker et al. 2019), but this was not reproduced in the Cellosaurus ancestry estimates (from Dutil et al. 2019). It was prepared for a slightly different reason, but I have some additional notes here. Basically, I think difference may be due to Hooker et al. 2019 using 2 Chinese populations (CHB and CDX) as a proxy for Native American ancestry.

      So, if others might make a similar assumption, then I thought being able to visualize separate East Asian and Native American estimations might be helpful. I don't know how common that might happen, but I was aware of at least one example.

      Thank you very much!

      Sincerely,<br /> Charles

    1. On 2022-06-29 15:36:43, user Iratxe Puebla wrote:

      Review coordinated via ASAPbio’s crowd preprint review

      This review reflects comments and contributions by Sónia Gomes Pereira, Rachel Lau, Sam Lord, Sanjeev Sharma, Parijat Sil. Review synthesized by Richa Arya.

      General comments

      It may be helpful to elaborate on how it is established that CHIP mobility is dependent on activity. The conclusion in the paper has been primarily drawn from the catalytically inactive H260Q mutant which is less mobile. However the fact that the puncta of the mutant are brighter and larger than the wild type and that it recovers slowly also indicates the protein might be inherently more prone to aggregation upon heat shock.

      Related to the above point, under conditions such as VER treatment and Act-D treatment, the nucleolar recruitment is unaltered but recovery is affected (which implies mobility may be affected). This leads to the accumulation of CHIP in the nucleus. In these scenarios, it may be relevant to report on the status of wild type CHIP activity? Conducting the ubiquitination assay as in Figure 5A with Act-D and Ver treatment would be informative. If no difference in ubiquitination is observed, it can be concluded that it is not the change in CHIP mobility that affects its activity, but rather it's activity that promotes CHIP mobility/dynamics (the conclusion from Figure 5).

      o Figure 1: The question arises as to why the control and recovery show puncta in panel C, but not the HS condition. Also, to make it easier to appreciate the nucleolar localization of CHIP in the HS condition, zoomed in regions and overlay images would be useful.

      Figure 1b: To support interpretation of the results, it would be helpful to highlight some examples of the nucleolar localization of CHIP. Additionally, it looks like there are specific dots (that could be like condensates) in the Control and Recovered, but not during the Heat Shock cells, not in panel B. Maybe some quantification such as number of dots per cell/ intensity/size could accompany the images. Similar parameters of the condensate structures in the nuclei in the transiently transfected cells could be quantified.

      Figure 1: Quantifications such as 2B and 2C could also be done for Figure 1, for both Hsp70 and CHIP.

      Figure 1E..’ K30A mutant exhibited impaired CHIP migration to nucleoli after heat shock (Fig. 1E)…’ How strong is this impairment? Could it be quantified either by fluorescence intensity or via Western blot of the different cellular fractions.

      o Figure 2: It would be helpful to have additional clarification on what the different parameters such as -"% of cells with EGFP-CHIP in the nucleolus' or 'CHIP intensity in the nucleolus' represent, as well as clarification on the transition from measuring CHIP nucleolar-to-nucleus intensity ratios for immunostaining (as in Fig S1E) to measuring just nucleolar CHIP intensities in the main Figure for the EGFP-CHIP overexpression experiments. Perhaps a western blot showing HSP70 expression with VER might be helpful in demonstrating that total protein expression is not affected and that it is only its activity being affected.

      a small molecule inhibitor of HSP70…’ Some suggestions alongside the loss of function assays such as knockdown and inhibitor treatment:

      What happens to Hsp70 and thereby CHIP translocation to the nucleus in cells with high, medium versus low levels of HSP70 expression? Do the high-expressing cells show more enhanced CHIP recruitment to the nucleolus? Can it be quantified as to how correlated the efficiency of recruitment of CHIP is to the expression level of Hsp70? How does the nucleolar translocation of Hsp70 itself correlate with its expression level?

      Figure 2a: It is clear that the HSP70 co-localises with CHIP upon heat shock. Overlaid images might be better to highlight this but the use of green and red is not ideal for colour-blind readers. May be changed for bar graphs too (2d,e).

      Figure 2b,c: There is a question about the statement that mutant CHIP was unable to localise in the nucleoli due to lack of HSP70 binding in Fig 1E. In Fig 2B and 2C CHIP was able to migrate into the nucleoli (albeit at a lesser extent) with HSP70 knockdown? Maybe images corresponding to this experiment might help as well to allow the reader to see the difference in localisation? It is mentioned that CHIP auto-ubiquitination is important in its localisation in Fig 5 so does the CHIP K30A mutant necessarily verify that the lack of HSP70 binding is causing impaired migration to the nucleus in Fig 1E? Could K30A also affect its auto-ubiquitination? Suggest referencing supplementary figure 2 alongside Fig 2B and 2C, and changing the dots in this graph to red, to make it consistent with panel F.

      Figure 2d,e: Bar plots could be replaced with scatter plots showing individual data points as done in Supp. Fig 1E. Adding t1/2 values with FRAP traces would support the changes observed for recovery times across conditions. Calculating mobile fraction and reporting would also be helpful.

      Figure 2f,g: Suggest updating the figure legend to clearly distinguish both curves. Some additions may complement the FRAP analysis presented:

      • How does the FRAP mobility of CHIP compare between absence and presence of heat shock?
      • How does the FRAP mobility of CHIP compare in the recovery phase in presence and absence of heat Ver?
      • Is the CHIP mobility different in nucleolus versus nucleus?

      ‘and HSP70 inhibition did not si+gnificantly reduce its dynamics (Fig. 2F)…’ Would there be any change in CHIP dynamics in siHSP70 cells? It would be helpful to mention this following Fig 2B/C. Maybe use 'mobility' instead of dynamics, to be more specific.

      o Figure3: It will be helpful to include an overlay/merged image of the two channels, and to explain in the legend how the measured correlation coefficient is obtained. It would be nice to see what kind of sub-structures show the maximum colocalization.

      Fig 3c: HS+Rec condition should show a loss of correlation between CHIP and NPM1 and is an important control in this figure. Comparison with Fibrilarin is good, demonstrating a loss of correlation between the NPM1 and CHIP themselves under different conditions and data for Ctrl only conditions would also add value.

      o ‘it altered CHIP distribution, which more prominently overlapped with Act D-induced NPM1 ring formations (Fig. 4D)…’ Can this be quantified? Maybe it will show more pronounced colocalization compared to heatshock alone.

      o 'this observation suggests that proper nucleolar assembly may be necessary for CHIP dynamics'. It may be worth specifying the reference to Dynamics here:

      1. Mobility measured via FRAP
      2. Translocation efficiency done via intensity measurement or ration of nucleolus/nucleus intensity. FRAP measurement of CHIP may be helpful to conclude about the mobility of CHIP in the nucleolus upon heat shock, in presence or absence of Act D pre-treatment. A change in mobility may support the lack of translocation during the recovery phase in presence of Act D.

      o Figure 4: (a) It may be worth commenting on why the Hoechst staining looks different between the Control and the Act-D conditions. Fig4d: It could be helpful to add images of NPM1 localization in cells treated with Act D, but not under heat shock. In other words, are these NPM1 rings specific to the heat shock response? The size of the cells and the nucleus are different for HS versus Act-D+HS panels. If the scale bar is consistent and this is a normally observed morphological change upon Act-D treatment, it might be helpful to note this size difference in the legend.

      o ‘We found that the activity of CHIP is not indispensable for heat shock-induced migration to the nucleolus (Fig. 5B). However, FRAP analysis of the nucleolar CHIP H260Q mutant showed a decrease in its dynamics compared to CHIP WT…’ Maybe the fragment could be rewritten for clarity (e.g. is dispensable). What happens to the mutant CHIPH260Q localization upon recovery? Is it slower than wt? Is more mutant CHIP retained in the nucleolus upon recovery?

      o Figure 5: Suggest showing a wt image as comparison, in panel B. An alternate interpretation for the observations with H260Q mutant could be that the mutation leads to instability and misfolding of CHIP (as suggested in the paper) which leads to increased aggregation (larger and brighter droplets, low mobility) upon heat shock with itself and other interacting proteins. This interpretation does not need to invoke a loss of ubiquitination activity as a cause, it could be another consequence of misfolded CHIP.

      Figure 5c: How do the mobility of wild type CHIP compare with the H260Q mutant in the nucleus or in absence of heat shock? If the mobility is the same during pre-heat shock/pre-translocation to the nucleolus, the wild type and mutant protein have inherently similar dynamics. And if this gets altered only in the nucleolus of heat shocked cells, it would support the conclusion that it is the activity of CHIP that helps retain its mobility in the nucleolus and possibly prevent its aggregation in this compartment.

      Figure 5f: If there were two independent experiments, can both be represented? Or was the data pooled from the two experiments?? Suggest representing the data as two points for CHIP wild type and mutant each, from two independent experiments.

      Figure 5g,h,i: Dot plot overlay on the boxplot might be nice to see the spread of datapoints.

      o ‘Interestingly, sizeable intra-nucleolar CHIP droplet-like structures could be observed after overnight heat shock in cells expressing the CHIP H260Q mutant, outnumbering their WT protein counterparts (Fig. 5E-I)…’ In Figure 1C some bright foci are also observed in control and recovered cells. Are these similar to the "droplet-like structures" described here?

      o ‘These differences between CHIP WT and mutant assemblies may stem from the alterations in CHIP H260Q dynamics within the nucleolus (Fig. 5C and D)’. Similar measurement as in Fig 5C could be done upon overnight heatshock to support this statement.

      o ‘Surprisingly, we found comparable redistribution of all CHIP variants to nucleoli during heat shock, suggesting an…'. Is this a cell line-specific difference, or could it be due to differences in approach, i.e. stable cell line vs. transient overexpression? Similar transient expressions in HeLa may help clarify this.

      o Based on Fig S1E, it appears there might be both an HSP70 activity-dependent (smaller) and HSP70 activity-independent (larger) contributions to CHIP localization. VER treatment reduces CHIP relocalization to the nucleus by a small but significant amount both in control and HS-treated cells.

      o Cell transfection - Suggest reporting the confluency of the cells before transfection (or at which they were seeded).

      Methods - In Figs 3C and 5G-I, there is a concern about the statistical approach to calculate p-values based on multiple measurements (nuclei) within each sample. The t-test and ANOVA assume that each measurement is independent, and multiple nuclei within the same sample are not independent. Recommend to either not report p-values or to average together the values from each sample and calculate the p-value using those sample-level means. For more information, see https://doi.org/10.1371/jou... and https://doi.org/10.1083/jcb....

    1. On 2022-06-28 18:41:39, user Shashank Srivastava wrote:

      Very interesting and well conducted study! I found a few reference errors though. Foltz et al. found UBR7 association with histone H3.1 (not with CENP-A) in Nature Cell Biology, 2006 not 2009 Cell paper. It should be corrected in Page 7 and 12 of the manuscript. <br /> Also, Hogan et al., EMBO, 2021 is relevant with regards to histone chaperone's role in histone deposition, and therefore should be considered to be referenced and discussed.

    1. On 2022-06-28 12:02:36, user CT wrote:

      Hello,

      This is a very interesting paper, but I would like to point that the mobility data used here have been determined with a fluorescent parS/ParB system that is now known to introduce artefacts in the Ter region, because it is sticky and therefore make the foci less mobile. Could you maybe discuss your results in light of this?<br /> See: Stouf et al 2013, Crozat et al 2020<br /> Many thanks

    1. On 2022-06-27 17:36:28, user Gibs wrote:

      Seems interesting (great name also)! Currently the GitHub link does not work. I imagine the repo is private - would it be possible to make it public now that the pre-print is out?

    1. On 2022-06-26 19:21:28, user Donald R. Forsdyke wrote:

      POSSIBLE MACROEVOLUTIONARY EXPLANATION

      Graham Coop appears content with this bioRxiv preprint publication, which would seem to present a true “version of record” of his thinking in 2016. (He did not have his text modified in response to the whims of journal reviewers or need to suffer the stylistic corrections of journal copyeditors.)

      Among those who provided feedback on earlier drafts, Coop lists Vince Buffalo who later (2021), more formally addressed the same topic in consultation with Coop (1). However, rather than naming bioRxiv directly, Buffalo cited Coop (2016) as having published in “Cold Spring Harbor Labs Journals” (2). This would seem not to have been picked up by automatic search engines, so no link to Buffalo (2021) is so far evident at this site.

      This is regrettable since Buffalo goes beyond Coop (and other commentators; 3) in suggesting that we should be considering macroevolutionary explanations for the failure of consensus population size (Nc) to relate to population diversity (“Lewontin’s paradox”):

      Finally, beyond just accounting for phylogenetic non-independence, macroevolution and phylogenetic comparative methods are a promising way to approach across-species population genomic questions. For example, one could imagine that diversication processes could contribute to Lewontin’s Paradox. If large-Nc species were to have a rate of speciation that is greater than the rate at which mutation and drift reach equilibrium (which is indeed slower for large Nc species), this could act to decouple diversity from census population size. That is to say, even if the rate of random demographic bottlenecks were constant across taxa, lineage-specic diversication processes could lead certain clades to be systematically further from demographic equilibrium, and thus have lower diversity than expected for their census population size.

      I have further addressed this topic elsewhere (4).

      1. Buffalo, V. (2021) Quantifying the relationship between genetic diversity and population size suggests natural selection cannot explain Lewontin’s paradox. Elife 10: e67509.

      2. Coop G. (2016) Does linked selection explain the narrow range of genetic diversity across species? Cold Spring Harbor Labs Journals; 2016.

      3. Charlesworth, B. & Jensen, JD. (2022) How can we resolve Lewontin's Paradox? Genome Biology & Evolution (doi/10.1093/gbe/evac096/6615374).

      4. Forsdyke, DR. (2022) Social Sciences Research Network. Speciation, Natural Selection, and Networks: Three Historians Versus Theoretical Population Geneticists

    1. On 2022-06-24 19:05:28, user Larissa Dougherty wrote:

      We want to thank the participating reviewers in ASAPbio’s Crowd Review for taking the time to provide thoughtful feedback for our preprint. We have responded to some comments below and in the next version, will revise the manuscript accordingly.

      “The majority of the conclusions about MAPK signaling are drawn based on the treatment with the BCI compound whose selectivity is unclear. It is possible that BCI could directly inhibit other phosphatases involved in ciliogenesis such as CDC14, PPP1R35. A reference pointing to the selectivity of BCI towards MKPs or alternatively rescue experiments with the inhibitor U0126 could address this issue.”

      We have cited Molina et al. 2009 who showed specificity for BCI hydrochloride in zebrafish. BCI targets primarily DUSP6, but also exhibited some activity towards DUSP1. In this study, the authors had also used zebrafish embryos to check expression of 2 other FGF inhibitors, spry 4 and XFD, in the presence of BCI but found that their effects were not reversed. In addition, they checked the ability for BCI to suppress activity of other phosphatases including Cdc25B, PTP1B, or DUSP3/VHR and found that BCI could not suppress these phosphatases. Though this is not to say that BCI is not inhibiting these proteins mentioned, but BCI inhibition has previously been found to be more specific to MAPK phosphatases.

      In addition, we have previously confirmed that U0126 has a slight lengthening effect on Chlamydomonas which further implicates this pathway in cilium length tuning (Avasthi et al. 2012).

      “It is shown that BCI leads to transient activation of the ERK activity which peaks within 30 minutes and starts fading away after around 60 minutes. However, most of the effects are studied at 2 hours, when the changes in the cilia length are most apparent. But the ERK activity at this time point is unclear. Simultaneous measurements of ERK activity and cilia length would strengthen the correlation between the two processes.”

      While ERK activity spikes early after BCI treatment, what we are assaying here are downstream effects following ERK activation. Our experiments primarily address these eventual outcomes rather than the immediate molecules participating in signaling. Here we show that ciliary shortening is a downstream effect, though we also show that ciliogenesis is immediately inhibited as well (30 minute and 60 minute timepoints included) to show that these processes are stopped in their tracks, but it takes 2 hours to see the measurable large-scale changes to the cell. We agree that MAPK is unlikely to still be active at the 2 hour time point given that ERK activation is decreased within 60 minutes.

      “Specific comments<br /> Introduction:”

      Thanks for the suggestions on wording. We will make minor edits to the wording per the helpful suggestions for clarity.<br /> “Results: <br /> Figure 1 <br /> Figure 1D – It is unclear in the figure whether the P-value is calculated between concentrations 0 µM and 45 µM, or between 0 and all three other concentrations. A similar comment applies to Figure 1H and Figure 1J.”

      We will revise the figures to indicate individual P-values from multiple comparisons. In Figure 1C, both 15 µM and 30 µM are significantly different from 0 µM. In Figure 1H and J, the differences between the control and 1.56 µM as well as the control and 3.13 µM are significant for ciliary length. For percent ciliation, they are not significantly different.

      “Figure 1F – Was any axonemal marker other than acetylated tubulin used to control for tubulin acetylation defects?”

      We have also measured Arl13B as a marker with and without acetylated tubulin staining and found consistent results regarding ciliary shortening in hTERT-RPE1 cells. In addition, we have measured acetylated tubulin in Chlamydomonas cells and have found consistent results with ciliary length changes compared to other markers such as non-acetylated B-tubulin and FAP138-GFP.

      “Figure 2<br /> Figure 2C – It is unclear if there is a difference in the fluorescence intensity distribution. A line profile along the cilia would indicate if there is any change in the spatial distribution of KAP.”

      While there may be additional effects on intra-ciliary KAP-GFP distribution that impact ciliary phenotype, we expect the decreased ciliary KAP-GFP to largely explain the profound effect on ciliary growth.

      “Figure SF 2C – Is it possible to elaborate more on what specific conclusion this data suggests.”

      Figure SF 2C acts as a control for Figure 3H. After a single regeneration event, cilia cannot initially regrow in BCI, but ultimately, at this lower concentration of BCI used, cilia can slowly begin to regrow possibly after overcoming the acute ERK activation with BCI. Additionally, after a single regeneration, there is enough ciliary protein present to normally regenerate cilia to half length (Rosenbaum et al., 1969). In Figure 3H, we show that upon completely depleting the protein pool through 2 regenerations (the first in the protein synthesis inhibitor cyclohexamide), cilia cannot begin to regrow after several hours until it is washed out. What we see here is that with existing ciliary protein present, though this protein cannot participate in immediate ciliogenesis until the cell overcomes BCI, the cilia can ultimately regrow. Following complete ciliary protein depletion and washout of BCI, cilia cannot regrow for several hours, which indicates a defect in ciliary protein synthesis during the BCI treatment period.

      “Figure 3 <br /> Figure 3B – Is there any reason why the BCI-induced regulation of MAPK signaling affects ciliary protein synthesis in particular? There seems to be no reduction in total protein synthesis.”

      In Figure 3B, we are quantifying the amount of KAP-GFP in the cell body versus in cilia. Consistent with our data that there is reduced entry of KAP-GFP into the cilia, we see this occur when we quantify this protein. These data are a fractionation of the cell body and cilia protein rather than a readout of protein synthesis. BCI prevents entry of KAP-GFP into cilia. These data suggest that although the quantities of protein are similar in BCI vs. control cells, the distribution of KAP-GFP is increased in the cell body and decreased in the cilia. It is not that there is a ciliary protein synthesis defect that we are seeing in Figure 3B, but the localization of ciliary proteins are altered in BCI.

      “Figure 4A – A clearer description of how BCI “partially” disrupts the transition zone would be beneficial. Cross-sectional imaging of the transition zone with higher concentration of BCI might make changes in the structure more apparent.”

      By “partially” disrupts the transition zone, we are referring to BCI altering some protein composition without altering the complete transition zone structure. This suggests that BCI is not directly impacting or disrupting the entire transition zone, just parts of it. We see a change in NPHP4, but the lack of structural changes by EM suggests that the proteins giving rise to the EM-visible structures are relatively unperturbed.

      We agree that it might be easier to see visible changes with higher concentrations of BCI. Interestingly though, we do not see a dose dependent change in NPHP4 fluorescence at the transition zone. The addition of BCI decreases the signal uniformly at all concentrations. It remains, however, a possibility that other transition zone proteins may be affected more drastically with BCI than NPHP4.

      “Figure 5<br /> Figure 5A – 36 µM BFA affects cell morphology and may affect the viability of the cells, can some further clarification be added about this and the concentration used.”

      In reference to impacting cell viability, for these experiments, we could not wash out 30 µM BCI paired with 36 µM BFA. Either this was too toxic or had very potent effects on the cell that prevented them from reassembling cilia. However, with the slightly lower concentration of 20 µM BCI paired with 36 µM BFA, we were able to wash out the drugs successfully and rescue ciliary regrowth. At this lower concentration, we noted that cilia shorten faster and more drastically than in either drug alone which is represented in the graph. We did not graph the higher concentration of 30 µM BCI paired with 36 µM BFA due to inability for cilia to regrow post washout. Given that the lower concentrations allowed us to draw conclusions about the membrane source, we plan to remove the sentence about toxicity at 30 µM BCI.

      In reference to morphology, we cite Dentler 2013 who went into detail about how 36 µM BFA collapses the Golgi using EM. Dentler also shows that the Golgi is an important source of membrane for cilia which is ultimately why cilia shorten in BFA. In our study, we wanted to see if BCI impacted Golgi-derived membrane traffic. We looked at the Golgi with EM and did not see collapse despite the faster ciliary resorption seen with coupling 20 µM BCI and 36 µM BFA, though we did not look at EM with the paired drugs.

      “Figure 6<br /> Figure 6C – The three categories mentioned in the text are not mentioned in the figure.”

      We have included measurements for full microtubule cages only for clarity in the main data; however, in the supplement we have included distinctions in the measured data between full vs. partial cages to provide a more complete story where the full-cage-only measurement may not tell the whole story.

    2. On 2022-06-22 15:49:19, user Iratxe Puebla wrote:

      Review coordinated via ASAPbio’s crowd preprint review

      This review reflects comments and contributions by Joachim Goedhart, Sónia Gomes Pereira, Ricardo Bruno Carvalho, Anchal Chandra, Akanksha Verma, Claudia Molina, Richa Arya, Rachel Lau, Xianrui Cheng, Ehssan Moglad, Rinalda Proko, Luciana Gallo, Parijat Sil, Yogaspoorthi Subramaniam. Review synthesized by Vasanthanarayan Murugesan.

      The reciprocal regulatory relationship between the cell cycle and ciliogenesis is poorly understood. This study by Dougherty et al. aims to better understand how MAPK signaling pathways control ciliary assembly in Chlamydomonas and RPE1 cells. ERK1/2 is a MAPK protein that is activated predominantly by MEK1/2 and deactivated by DUSP6.

      For this, the study activates ERK, a well-known MAPK pathway, by inhibiting its phosphatase DUSP6 through the compound BIC ((E)-2-benzylidine-3-(cyclohexylamino)-2,3-dihydro-1H-inden-1-one). The study shows that BIC leads to impaired ciliary assembly and maintenance in Chlamydomonas and impaired ciliary growth in hTERT-RPE1 cells. It further shows, in Chlamydomonas, that BCI inhibits ciliogenesis by disrupting total protein synthesis, microtubule organization, membrane trafficking, and partial kinesin-2 motor dynamics.

      The use of superplots to distinguish between the biological and technical replicates was well received by the community. The discussion is well written and ties together the various experiments conducted in this study. Certain sections could be rephrased to provide more clarity for readers.

      The following items of feedback were raised, to help solidify the claim that BCI affects ciliary assembly only through MAPK signaling:

      The majority of the conclusions about MAP signaling are drawn based on the treatment with the BCI compound whose selectivity is unclear. It is possible that BCI could directly inhibit other phosphatases involved in ciliogenesis such as CDC14, PPP1R35. A reference pointing to the selectivity of BCI towards MKPs or alternatively rescue experiments with the inhibitor U0126 could address this issue.

      It is shown that BCI leads to transient activation of the ERK activity which peaks within 30 minutes and starts fading away after around 60 minutes. However, most of the effects are studied at 2 hours, when the changes in the cilia length are most apparent. But the ERK activity at this time point is unclear. Simultaneous measurements of ERK activity and cilia length would strengthen the correlation between the two processes.

      Specific comments

      Introduction:

      “The cell cycle and ciliogenesis utilize the same structures at different times” can be written as “The cell cycle and ciliogenesis utilize centrioles at different times” as centrioles is the only structure mentioned in the text.

      Small item - “Ciliogenesis occurs when cells the exit cell cycle” to “exit the cell cycle”

      Recommend revising the segment “The ERK pathway controls the cell cycle” as it mostly talks about ERK regulation rather than how the pathway regulates cell cycle.

      Small item – “In C. elegans, mutations to MAPK15 directly regulate...” can be rewritten as “In C. elegans, MAPK15 directly regulates…”

      Results:

      Recommend revising the section “BCI-induced ERK1/2 phosphorylation disrupts ciliary maintenance and assembly in hTERT-RPE1 cells”. The timings of ciliary shortening and its relationship to ERK activation is unclear. In the concluding statement, ciliary assembly was used instead of ciliary shortening despite the data in Figure 1H showing that ciliary assembly is unaffected by BCI.

      “Decreased KAP-GFP at the basal bodies” – This appears to be in contradiction to Figure 2B.

      “These data suggest that BCI inhibits the mechanisms and proteins involved in cytoplasmic microtubule reorganization.” – Recommend adding further clarification about this sentence.

      Figure 1

      Figure 1D – It is unclear in the figure whether the P-value is calculated between concentrations 0 µM and 45 µM, or between 0 and all three other concentrations. A similar comment applies to Figure 1H and Figure 1J.

      Figure 1F – Was any axonemal maker other than acetylated tubulin used to control for tubulin acetylation defects?

      Figure SF 1E – Though the MKP2 mutant does not regenerate to wild type length, it does return to its own original length, can the text be adjusted to reflect this?

      Figure 1G-J – The conclusion in the text that BCI prevents cilia assembly could be clarified, as the data shows growth inhibition rather than assembly inhibition.

      Figure 2

      Figure 2C – The legend is slightly cut off from the image.

      Figure 2C – It is unclear if there is a difference in the fluorescence intensity distribution. A line profile along the cilia would indicate if there is any change in the spatial distribution of KAP.

      Figure SF 2C – Is it possible to elaborate more on what specific conclusion this data suggests.

      Figure 3

      Figure 3B – Is there any reason why the BCI-induced regulation of MAPK signaling affects ciliary protein synthesis in particular? There seems to be no reduction in total protein synthesis.

      Figure 4

      Figure 4A – A clearer description of how BCI “partially” disrupts the transition zone would be beneficial. Cross-sectional imaging of the transition zone with higher concentration of BCI might make changes in the structure more apparent.

      Figure 5

      Figure 5A – 36 µM BFA affects cell morphology and may affect the viability of the cells, can some further clarification be added about this and the concentration used.

      Figure 6

      Figure 6C – The three categories mentioned in the text are not mentioned in the figure.

    1. On 2022-06-23 14:34:06, user Andres Romanowski wrote:

      Hi people! This is great. Thanks for doing this! I hope you get this published soon. I was wondering if you plan to update AtRTDv3 to use the Col-CEN T2T genome. Thank you!

    1. On 2022-06-23 10:55:01, user Chiara Damiani wrote:

      Hi. There is some imprecision in referencing to our scFBA tool. The paper states "Existing analysis tend to portray the average change of intermixed and heterogeneous cell subpopulations within a given tissue [22-24]". However, in ref 22 we do predict single-cell fluxes! Simply we do not use neural networks, but we use Linear Programming to do that. Best regards, Chiara

    1. On 2022-06-22 20:32:02, user Iratxe Puebla wrote:

      Review coordinated via ASAPbio’s crowd preprint review

      This review reflects comments and contributions by Ruchika Bajaj, Michael Robicheaux, Akihito Inoue, Justin Ouedraogo and Kunal Shah. Review synthesized by Ruchika Bajaj.

      The paper reports the use of an optimized computational model, GMMA, by preparing a randomly mutated protein library and screening the mutant library using an in-vivo genetic sensor for folding for successful protein engineering efforts.

      Here are a few points of feedback on the paper.

      1. In the second paragraph of section, “Resilience towards mutations reflects thermodynamic stability”, the manuscript refers to the design of degenerate primers, “These were designed to cover the C-terminal half of edF106, amino acid residues 48-97”. Further explanation for designing degenerate primers for these specific positions would be helpful to the reader, for example by adding references from the literature. In the same paragraph, when mentioning the size of the library (10,000 - 20,000), it would be good to explain the reason for the specified size of this library.
      2. The section, “GMMA analysis discovers stability effects”, mentions that, “Reliable stability effects could be assigned to 374 out of the 838 unique substitutions in the library”. Further explanation may be provided in this regard, for example to describe why/what variables could lead to unreliable stability scores for tested substitutions.
      3. The study evaluated MM3 and MM6 combinations for the additivity of stability. It would be relevant to mention if other combinations like MM4 and MM5 were evaluated.
      4. Fig 2b: more points could be taken on the steep regions.
      5. For Supplementary Figures 4 and 5, please provide an explanation of curves or straight lines and explain the angle of fitted lines.
      6. In the section “stability measurements validate GMMA”, in the sentence, “Thus, mutations which could be stabilizing in the fusion might behave differently outside of the CPOP context.”, would it be possible to elaborate more on this statement to clarify how the behavior may differ?.
      7. Please indicate specific mutated amino acids in multiple mutants: MM3, MM6 and MM9, for comparison.
      8. Please label residues in Figure 6b.
      9. In the section, “Crystal structures show increased similarity to the 1FB0 design template”, the statement, “Only one or two would yield crystals indicative of a conformational change taking place in order to stabilize the crystal lattice.” Conformational change is questionable here, especially with low RMSD values. Would it be possible to elaborate on the statement or reframe it.
      10. “showed much better agreement with its original design template spinach thioredoxin (PDB: 1FB0).” It may be helpful to provide some further context about this in the Introduction and conclusions sections.
      11. In the section, “structure and sequence-based methods do not predict most stabilizing variants”, the text mentions the discrepancies in rosetta and GMMM. It may be relevant to provide some further discussion on what may be behind those discrepancies.
      12. Although the mutated protein has been crystallized, a discussion on protein expression or oligomerization after the mutation and its relation to thermal stability would be helpful for the study.
      13. A major point which has not been mentioned in this study is scoring of these mutations according to their function, functional aspects are important for the purpose of protein engineering and thus this could be relevant. It will also be good to correlate the stability of these mutants with its function to comprehend the protein engineering effort.
      14. Minor point: In the section, “Initial library transformation”, please change “scraped off” to picked off. <br /> 15, Supplementary Table 4: Wilson B factor value is missing for eMM9. A possible explanation for the difference in the number of macromolecules in MM9 and eMM9 variants would be helpful. Is there a possibility of change in crystallographic oligomerization ? Any information regarding regions of protein where Ramachandran outliers are located would be helpful.
    1. On 2022-06-22 13:39:06, user Prof. T. K. Wood wrote:

      Simply no evidence ANY of these phage systems cause cell death. When did we stop seeking evidence for something before invoking it?

    1. On 2022-06-22 12:18:53, user shashi shekhar singh wrote:

      Highly significant research done by authors and this manuscript may encourage the researchers to develop precise strategies for treating the pan-resistant bacteria.

    1. On 2022-06-21 13:17:37, user Davidski wrote:

      Hello authors,

      Thanks for making the genotype data available so quickly. A few points after running the data, copy pasting from my blog...

      • in terms of fine scale ancestry, the Erfurt Jews show enough variation to be divided into three or four clusters, as opposed to just two as per Waldman et al.

      • some of the Erfurt Jews show excess "Mediterranean" ancestry, while others excess "North African" ancestry, and this cannot be explained with ancestral populations similar to Lebanese and/or South Italians, but rather with significant gene flow from the western Mediterranean and possibly North Africa

      • several of the Erfurt Jews show relatively high levels of "East Asian" ancestry that cannot be explained with admixture from Russians, or even any Russian-like populations, because such populations almost lack this type of ancestry, and instead show significant "Siberian" admixture

      • as far as I can see, there are no correlations between any of the observations above and the quality of the samples. That is, low coverage doesn't appear to be causing the aforementioned excess "Mediterranean", "North African" and/or "East Asian" ancestry proportions.

      More at this link:

      https://eurogenes.blogspot....

      Cheers, David Wesolowski

    1. On 2022-06-21 06:12:51, user Effie Bastounis wrote:

      In Figure 3h the figure legend is correct but in the actual figure you need to correct the colors. I.e. blue should be the local isotropic stress and red the change in the area of the hole!

    1. On 2022-06-18 21:26:56, user Gagandeep singh wrote:

      Nice article. However as a suggestion, you should expand the ADMET table as it is not covering all the ADMET properties.

      Also you can do metadynamics analysis of the trajectory (Free energy landscape, PCA, mode vector etc), MMGB/PBSA calculations, Network analysis of the residues, density distribution of RMSD/RMSF/RG, Binding pocket dynamics in terms of appearance/disappearance of pocket/change in pocket volume. Such kind of additional trajectory analysis will support your manuscript.

      Best Regards,<br /> Gagandeep Singh<br /> Assistant Research Officer <br /> CCRAS, Ministry of AYUSH, Gov. of India,

      Ph.D. Scholar<br /> KSBS, IIT Delhi

      gagan.sk.1994@gmail.com

    1. On 2022-06-18 13:53:05, user Marc RobinsonRechavi wrote:

      Dear Yamaguchi et al,

      You write under Data accessibility:

      All code necessary to repeat the analysis described in this study have been made available. SLiM source codes of our model for speciation dynamics will be hosted on Dryad Digital Repository upon acceptance. There are no data to be archived.

      This is a publication, i.e. it is made public as part of the scientific record and is citable, thus I strongly invite you to make the corresponding source code available without delay.

    1. On 2022-06-17 19:18:38, user Yuangao Wang wrote:

      After months' negotiation with the manufacturer, the Solution A, one of the key reagent of this protocol for the success of obtaining pure eccDNA, has become globally available now.

    1. On 2022-06-16 16:47:00, user Elena L. Paley wrote:

      Leading corresponding authors are not available for contact/comments<br /> No citation of our earlier studies on the tryptamine-related subject:<br /> https://pubmed.ncbi.nlm.nih...<br /> Tryptamine induces tryptophanyl-tRNA synthetase-mediated neurodegeneration with neurofibrillary tangles in human cell and mouse models<br /> https://pubmed.ncbi.nlm.nih...<br /> Diet-Related Metabolic Perturbations of Gut Microbial Shikimate Pathway-Tryptamine-tRNA Aminoacylation-Protein Synthesis in Human Health and Disease<br /> Abstract<br /> Human gut bacterial Na(+)-transporting NADH:ubiquinone reductase (NQR) sequence is associated with Alzheimer disease (AD). Here, Alzheimer disease-associated sequence (ADAS) is further characterized in cultured spore-forming Clostridium sp. Tryptophan and NQR substrate ubiquinone have common precursor chorismate in microbial shikimate pathway. Tryptophan-derived tryptamine presents in human diet and gut microbiome. Tryptamine inhibits tryptophanyl-tRNA synthetase (TrpRS) with consequent neurodegeneration in cell and animal models. Tryptophanyl-tRNA synthetase inhibition causes protein biosynthesis impairment similar to that revealed in AD. Tryptamine-induced TrpRS gene-dose reduction is associated with TrpRS protein deficiency and cell death. In animals, tryptamine treatment results in toxicity, weight gain, and prediabetes-related hypoglycemia. Sequence analysis of gut microbiome database reveals 89% to 100% ADAS nucleotide identity in American Indian (Cheyenne and Arapaho [C&A]) Oklahomans, of which ~93% being overweight or obese and 50% self-reporting type 2 diabetes (T2D). Alzheimer disease-associated sequence occurs in 10.8% of C&A vs 1.3% of healthy American population. This observation is of considerable interest because T2D links to AD and obesity. Alzheimer disease-associated sequence prevails in gut microbiome of colorectal cancer, which linked to AD. Metabolomics revealed that tryptamine, chorismate precursor quinate, and chorismate product 4-hydroxybenzoate (ubiquinone precursor) are significantly higher, while tryptophan-containing dipeptides are lower due to tRNA aminoacylation deficiency in C&A compared with non-native Oklahoman who showed no ADAS. Thus, gut microbial tryptamine overproduction correlates with ADAS occurrence. Antibiotic and diet additives induce ADAS and tryptamine. Mitogenic/cytotoxic tryptamine cause microbial and human cell death, gut dysbiosis, and consequent disruption of host-microbe homeostasis. Present analysis of 1246 participants from 17 human gut metagenomics studies revealed ADAS in cell death diseases.<br /> More links to our relevant published articles available and delivered to corresponding authors. Our earlier studies demonstrated that tryptamine induces glucose metabolism alterations in blood and in brain. Furthermore, human gut microbial tryptamine increases revealed in the human population with a high prevalence of diabetes. More references are at the web site: www.stopalzheimerstest.com<br /> I have more comments on this preprint.

    1. On 2022-06-16 02:27:16, user Sciency wrote:

      This is a fascinating article to read, and I look forward to learning more. I'm going to take it step by step, commenting on clarity as I read through the paper.

      • I stumbled a few times in the abstract. " A deeper sampling of individual ants from two colonies that included all available castes (pupae, larvae, workers, female and male alates), from both before and after adaptation to controlled laboratory conditions, revealed that ant microbiomes from each colony, caste, and rearing condition were typically conserved within but not between each sampling category." <br /> What does "deeper" mean, is it that you sampled ants from each caste? (the way it's phrased now, it sounds somewhat detached, like stating that the colony had castes without stating that you sampled them) <br /> So colony number, caste, and wild vs lab are sampling categories? What would it mean "within, but not between each sampling category"?

      • What kind of sequencing did you do? I'd like to see at a glance which -omics you are doing, right at the start of the paper, because I sometimes look for papers that use a particular method.

      • You use "Tenericute" in the abstract, and "Mollicute" in the Importance section. For the readers unfamiliar with the two, it might be good to disambiguate.

      • The Importance section is somewhat long and repeats a lot of the abstract. What made you want to do this study? That no one has studied this ant's microbiomes? That the findings might extrapolate to other ants? That you could say something about individuality and colonial organization or evolution from the members' microbiomes?

      • "Honey bee queens, workers, and drones also each have unique gut microbiomes, where worker microbiomes are more diverse than those of queens and drones, possibly due to worker foraging (9)." "Unique" has the connotation of being individual, rather than a group characteristic. Would "discrete" be a better term? And I'm a bit confused by "more diverse". Diverse how? Is the meaning that the range of species within the microbial community is somehow wider on the taxonomic tree? Or something else?

      • But now reading that honey bees have a core microbiome that is found in all colonies and castes. But were we not talking about "more diverse"?

      • "However, strains [...]" just need to be a bit clearer on what are these strains of.

      • What makes these microbiomes "low-diversity"?

      • " the samples collected from each colony were not differentiated from each other" is unclear. Do you mean that the team collected ants of caste X from all 25 colonies into a single blended sample? Try to rephrase " Whether the 19 common bacteria found in Texas T. septentrionalis and form a conserved microbiome that is found in other geographic regions or castes is also unknown." is unclear to me. Maybe try to break it up into shorter sentences.

      • "major driver" might suggest causality. I think you mean that the differences in the presence or absence of those symbionts are producing the statistical effect of seeing differences between microbiomes, is that correct?

      • "Colony JKH000270 lab-maintained ants were sampled after a year and 4 months (some male alates were sampled earlier) and Colony JKH000307 lab-maintained ants were sampled after 4 months."<br /> I'm wondering if the time factor would be important in microbiome adaptation. If it is, can the two colonies really be compared to each other? Would you mind adding a couple of sentences to explain the procedure?

      • I'm not sure I understand how pupae and ant guts and whole ants will act as confirmatory datasets. Would you mind elaborating?

      • "Reads that were not classified as belonging to the kingdom Bacteria (i.e., those identified as Archaea or Eukaryote) using the SILVA database v128 (43, 44) were removed." I understand that including viruses, other fungi, diatoms, etc. would change the scope of the project. I'd be interested in learning about that part of the microbiome, and hope you write the next paper on it.

    1. On 2022-06-16 00:58:14, user Sciency wrote:

      Overall, I love this paper. It's an original approach, and an important topic. The language is clear and engaging. I do have some questions and comments that I hope might be helpful.

      • "integral parts of an imperialist enterprise [20]. Imperialism granted Western scientists unprecedented access to the world, which they translated into scientific authority, power, and wealth," When I first read that, I thought you meant "power and wealth" as in technology that spurred the Industrial Revolution. Later on in the paper, you elaborate that it is the power of Global North academics over academics in the Global South. I'm also thinking that maybe applied science, such as concentration of Big Pharma exploration and production would generate power and wealth today? Later on, you write " Implicit in this perspective is that first authorship, and authorship of publications in general, are ways to establish authority and accumulate power in knowledge production, which in itself is worth questioning. For example, how do established authorship norms promote inequity and dominance in Western science (e.g. [74])?" <br /> Pretty much the question I had. So, would it be possible to phrase the statement that is at the start of the paper in some way that lets me know to wait for that discussion at the end of the paper?<br /> You go on to explain: "The imperialistic dynamics that created the current structures of access and power within Western science between the Global North and South have also enabled Western science to assert dominance in global knowledge production [76], while erasing, appropriating, and subjugating Indigenous knowledge and authority. "<br /> Which leads me to believe that you only meant academia power. So, basically, I'm a bit confused by the flow. But the ideas themselves are powerful and I'm glad to read them.

      • "through foundational practices" I understand that you mean foundational to science, not the imperialism here?

      • "as expertise about the natural world continues to be disproportionately claimed by the Global North through publication practices. Our findings serve as a case study that reflects the inequitable structures at the core of Western biodiversity science and their resulting disparities, e.g. in access, labor, collaboration, power, and designations of expertise and authority.". To me, this is the most important statement. And yet it's pretty far down, at the very end of the Introduction section. On the one hand, I understand that it is the last step in a logical chain. On the other, I would still like it to be one of the first things I see, to let me know what I'm reading towards.

      • "This study shows how historical inequity continues to shape present day research practices" I'm not sure it does? To me, it shows the historical inequity, and it shows that inequity is still here today. But I don't know if the paper describes the mechanism by which one generates the other. And don't think it needs to, what the paper focuses on is far more important. So I'd just rephrase that a bit to remove the suggestion of causality. "Things are bad. Things are still bad. We should think about that and fix it."

      • "1960". I'm cool with missing the years between 1950 and 1960, I just want to see a phrase acknowledging that, and saying you accounted for it in the statistics.

      • "we did not include descriptions in which the species was extinct at the time of description" Could you add a quick phrase explaining why? As a fresh reader, I thought "I'd feel it an honor to have a dinosaur named after me". And I'm genuinely curious what is the quality of that honor that makes it different from having a current species.

      • "The prevalence of first authors from the Global South increases significantly toward the present (R2 = 0.143, p = 0.014), but the prevalence of first authors from the Global North remains consistent (R2 = 6.749e-5, p = 0.947) "<br /> Is it not a zero-sum calculation? Earlier, you make a similar statement, but without the word "first", so I concluded that Global South authors were being included as author lists generally grew in length. But there can be only one first author per paper, so I'm confused by the calculation here.

      • In this paper, you speak of inclusion of Global South stakeholders in Western science. You also speak of inclusion of Indigenous knowledge and worldviews in science. So the "The patterns of authorship we observed show that researchers from the Global South have increasing opportunities to participate in Western science" statement feels like it's missing a piece.

      • "prioritizes the Global North’s power to theorize and conceptualize [...] frames the value of people and their perspectives in terms of how they can benefit those currently in power"<br /> and<br /> "Paradoxically, as taxonomic work has been devalued, [...] the roles of different individuals, and how different roles are supported and valued (intellectually and materially)" Loved reading this.

      • "Adhering to the fallacy of neutrality (which is in fact a non-neutral stance and one embedded in white supremacy;" I understand that thinking one is neutral is a fallacy. But how is it a non-neutral stance embedded in white supremacy? Is it because privileged people have the ability to not see problems and therefore think they're being neutral? I would want to see a bit more clarity in this phrasing.

      Thank you for writing the paper, look forward to seeing it in print.

    1. On 2022-06-14 23:54:40, user Raj_Operon wrote:

      MPST provides sulfur to the downstream enzymes such as MOCS3 which then transfers to Urm1. Urm1 then transfers the sulfur to CTU1/CTU2 complex that thiolates the tRNA at U34 position.<br /> How just the shMPST could be concluded as the main enzyme playing the role in oxidative stress in glioblastama.<br /> There is clearly a possibility that shMPST knockdown decreases the tRNA thiolation levels which then leads to the effect seen here.

      And the Dimedone switch labelling method for detecting the persulfided proteins is not selective as claimed in the method. A coomassie stained gel for the Figure 5 A, B would be helpful since the P-SSH lane seems to have degraded/low molecular proteins alone persulfided (from the intensity).

    1. On 2022-06-14 18:49:19, user CJ San Felipe wrote:

      In this paper, the authors analyze an intrinsically disordered region (IDR) of the yeast general recognition factor Abf1 with the aim of identifying functional determinants of Abf1’s IDR. The advantage of the authors’ plasmid shuffle experiments is that it allows the study of many mutations and variations of Abf1. The authors reveal that Abf1 possesses an essential motif (EM) as well as several contextual residues that work together to mediate Abf1’s function. Upon further investigation of compositionally and functionally similar IDR’s, the authors hypothesize that sequence specificity and chemical context in IDRs functionally overlap with each other rather than act independently, and propose a 2D model to describe the contributions of each in IDRs. <br /> The major success of this paper is in developing a model that reconciles two contributors to IDR function: sequence specificity and chemical context. The major weakness of the paper is that the model is not comprehensively backed with control experiments. The 2D landscape model presented argues that modulation of essential motifs and contextual amino acids can produce several binding modes; however, no data is presented to show that these chimeras are viable because they interact with the same factors or function in the same way that IDR2 does. Therefore, we can’t be certain if these are off-target effects or the same interactions that occur with IDR2 as put forward in the model. In addition, we found some aspects of the organization of the paper may require more clarity. Overall, the paper reveals some of the functional determinants for Abf1’s IDR and proposes an intriguing model for the functional determinants of other IDRs, but it could be difficult for these findings to be generalized.

      Major points<br /> p.4: <br /> It is unclear to us why the minimal viable construct IDR2 449-662 is the background reference construct. Is it possible that IDR1 (absent in this construct) could provide unknown benefits in particular situations? For example, given the unknowns of Abf1’s interactome, is it possible that IDR1 helps to activate transcription of other genes that could rescue IDR2 mutants? Perhaps the presence of IDR1 could confer viability for IDR2 mutants that were deemed not viable in later experiments. Plasmid shuffle assays with IDR2 mutants that also have IDR1 present could be control experiments that answer this question.

      p.4 <br /> The constructs generated in this paper are tested for viability via plasmid shuffle assay, but there is no control experiment to ensure that these constructs are still interacting with the same partners or functioning in the same way that wildtype IDR2 does. One possible control experiment to test this could be to choose an Abf1-interacting partner based on proteomic literature on Abf1, and perform a co-immunoprecipitation/Western blot to see if the partner is still present across different IDR2 mutants. This control experiment should be done with full length Abf1, the background reference construct (with no IDR1), as well as a construct without the EM and a shuffled construct to represent the two extremes of the 2D landscape.

      p.5: <br /> The decision to choose the G4 motif does not have a strong justification or explanation. In figure 3F it is shown from the alignment between Abf1 and Gal4 that the region considered to have sub-homology does not overlap with the essential motif of Abf1 nor does it show similarity in its sequence. Therefore, in our view, it does not appear that Gal4 has an EM that is homologous to the EM of Abf1.

      Figure S1 PDF:<br /> By eye, it appears that there is large variation between the strains considered inviable – for example, FUS_1_163_WT clone 3 on page 6 and Shuffle 3 clones 2 and 3 on page 3 are both marked as inviable yet differ in growth. It could be helpful to readers if an explanation about why a binary classification of viable vs inviable was used in this study, as opposed to a sliding scale quantification.

      Minor points<br /> For a future direction, after identifying the essential motif in IDR2 (EM), we think it would be compelling to go back to the orthologs initially tested to see how conserved the essential motif is evolutionarily and to see how divergent the orthologs that we’re inviable were. We also feel that this could be incorporated into the paper’s discussion.

      Figure 3: <br /> Panels G-K were difficult for us to understand due to the sheer number of constructs presented. To us, the contrast between sequence-specific motif and chemical context would be clearer if panels E and K were combined, perhaps with labels “sequence specificity” and “chemical context” below the respective constructs, to underscore the two ends of the spectrum that these panels represent and to emphasize the unexpected viability of the constructs in K.

      p.2-3: <br /> The hypothesis that poorly conserved IDRs may still retain functional conservation is compelling, but the proteome-wide analysis of disorder leading up to this hypothesis could be clarified in the methods section. In particular, it would be helpful to include an explanation of why and how disorder score from metapredict and predicted pLDDT were used in conjunction with each other, as opposed to using the predicted consensus disorder score from metapredict alone.

      We review non-anonymously: Daphne Chen, CJ San Felipe, James Fraser (UCSF).

    1. On 2022-06-14 09:07:35, user Prof. T. K. Wood wrote:

      1. Abstract: (i) No evidence of “programmed cell suicide” by anti-phage systems based on TAs and Pycsar, CBASS, etc.; merely metabolism is reduced.<br /> (ii) No undiscounted evidence that toxin MazF is a suicide protein.

      2. Not sure why the seminal discovery of phage inhibition by the toxin/antitoxin Hok/Sok system is not mentioned here. See doi:10.1128/jb.178.7.2044-2050.1996.

      3. Discussion: no credible link between (p)ppGpp and TAs.

    1. On 2022-06-14 08:57:51, user Joachim Goedhart wrote:

      The authors observe fluorescence in cells and biological tissue. The fluorescence is attributed to proteins and these are named human fluorescent protein I and II (HFP1, HFP2).

      However, there is no evidence that the fluorescence originates from a protein. The source of the emitted signal can be any (auto)fluorescent molecule (e.g. riboflavin).

      The labels in figure 3&4 are too small to read and prevent evaluation of those results.

    1. On 2022-06-14 08:39:13, user Jade Bruxaux wrote:

      Hi!<br /> Would it be possible to get access to the Supplemental methods / code mentioned in the text?<br /> Thanks in advance!

    1. On 2022-06-14 05:08:23, user Kazuo Takayama wrote:

      This study was published in "Communications Biology"

      Cell response analysis in SARS-CoV-2 infected bronchial organoids.<br /> Sano E, Suzuki T, Hashimoto R, Itoh Y, Sakamoto A, Sakai Y, Saito A, Okuzaki D, Motooka D, Muramoto Y, Noda T, Takasaki T, Sakuragi JI, Minami S, Kobayashi T, Yamamoto T, Matsumura Y, Nagao M, Okamoto T, Takayama K. <br /> Commun Biol. 2022 May 30;5(1):516. doi: 10.1038/s42003-022-03499-2.<br /> https://www.nature.com/arti...

    1. On 2022-06-13 08:30:22, user Sravasti Mukherjee wrote:

      This is an interesting study that shows very nicely the importance of biosensor expression levels in order to make accurate quantitative measurements and to adapt it for high-throughput screenings. However, the authors mention that genetically encoded biosensors (for e.g. cAMP sensors) are rarely used in high-throughput screenings. Probably they have overlooked a recent paper - [(Harkes and Kukk et al., 2021 - Dynamic FRET-FLIM based screening of signal transduction pathways) https://www.nature.com/arti...] in which they use an Epac based cAMP FRET sensor with FLIM as the readout and perform high-throughput arrayed siRNA based screen to study the breakdown kinetics of cAMP by the PDEs. Using FLIM as the readout of FRET sensors also circumvents some of the sensor expression level issues that are highlighted in this pre-print. Probably these are some points that the authors would like to take into account when revising their pre-print.

    1. On 2022-06-13 08:08:35, user Olivier Gandrillon wrote:

      This is a quite provocative view of the absence of cell types that could be identified through specific gene expression patterns in single-cell RNAseq data. My first comment is that Waddington was not the first one to propose the existence of distinct cell types, harbouring different functions. My second comment is more of a question: when you are using differentially expressed genes why do you still find no cluster structure? This seems weird to me. By definition of DE genes, they should define clusters. I fully agree that there should be some continuity in between cell types but at the same time tehre should be differences in between cell types.

    1. On 2022-06-11 01:40:19, user KeninSydney wrote:

      I may have misread the paper but shouldn’t one step have been to have two groups of mice without tumours and attempt to train the ants to select one of the groups?

      Maybe ants can distinguish individual mice by urine?

    1. On 2022-06-10 11:49:16, user Khaled wrote:

      Hello,<br /> I think there is a mistake in the affiliation order as all authors with 2 are in EMBL but in the affiliations 2 it's mentioned FHT, Italy.

    1. On 2022-06-10 06:33:11, user Jingyi Jessica Li wrote:

      Here is our formal response: https://www.biorxiv.org/con...

      In this response to the correspondence by Hejblum et al. [1], we clarify the reasons why we ran the Wilcoxon rank-sum test on the semi-synthetic RNA-seq samples without normalization, and why we could only run dearseq with its built-in normalization, in our published study [2]. We also argue that no normalization should be performed on the semi-synthetic samples. Hence, for fairer method comparison and using the updated dearseq package by Hejblum et al., we re-run the six differential expression methods (DESeq2, edgeR, limma-voom, dearseq, NOISeq, and the Wilcoxon rank-sum test) without normalizing the semi-synthetic samples, i.e., under the "No normalization" scheme in [1]. Our updated results show that the Wilcoxon rank-sum test is still the best method in terms of false discovery rate (FDR) control and power performance under all settings investigated.

      References<br /> 1. Hejblum BP, Ba K, Thibaut R, Agniel D: Neglecting normalization impact in semisynthetic RNA-seq data simulation generates artificial false positives. bioRxiv 2022.<br /> 2. Li Y, Ge X, Peng F, Li W, Li JJ: Exaggerated false positives by popular differential<br /> expression methods when analyzing human population samples. Genome biology<br /> 2022, 23:1--13.

    1. On 2022-06-08 05:41:00, user simon LECLERC wrote:

      This manuscript is finished at more than 70%.<br /> There are left a couple of experiment to conclude this research article.<br /> Feel free to comment here to improve this manuscript as much as possible!<br /> Thanks,<br /> Simon

    1. On 2022-06-02 15:44:26, user disqus_w4VlVyfN45 wrote:

      I'd like to hint self-plagiarism of one image of Ubx WT expression in figure 2 A, A’ (p.15). The <br /> same image is shown in another paper from the Patel Lab with changed color and labels: “Comprehensive analysis of Hox gene <br /> expression in the amphipod crustacean Parhyale hawaiensis” by Serano et al. (2016) figure 6 H <br /> (https://doi.org/10.1016/j.y....

    1. On 2022-05-31 07:58:53, user Stefanie Hiltbrunner wrote:

      Dear Colleagues,<br /> We thank you for suggesting a simple stratification of mesothelioma patients based on CDKN2, BAP1 and NF2 genetic alterations. In March 2022 we had also posted in a preprint (Hiltbrunner, Genomic Landscape of Pleural and Peritoneal Mesothelioma Tumors. https://ssrn.com/abstract=4... or http://dx.doi.org/10.2139/s...:wUx8toHkApFrgeD1WdGindoCNWY "http://dx.doi.org/10.2139/ssrn.4060087)") a similar and even simpler stratification, based on CDKN2 and BAP1, to separate both, pleural (n=1113) and peritoneal (n=355) mesothelioma patients in real world, using FoundationOne data collected in the US. NF2 was considered in the analysis, but not included in the stratification, since recent data suggests that NF2 mutations are late events. This allowed us to establish highly significant differences between the four groups, e.g. TP53 and RB1 mutations in the group with no BAP1 nor CDKN2 mutations.

    1. On 2022-05-31 06:39:26, user Prof. T. K. Wood wrote:

      Original JBac 1996 manuscript that discovered phage inhibition by toxin/antitoxin systems should be cited:

      doi:10.1128/jb.178.7.2044-2050.1996.

    1. On 2022-05-31 00:43:00, user ???? Dr. Jennifer Glass ???? wrote:

      Congratulations to the authors on the first report <br /> (to my knowledge)<br /> for metatranscriptomes from hydrate bearing sediment!

    1. On 2022-05-30 09:55:28, user Malcolm White wrote:

      We just became aware that one panel in extended data figure 3 was duplicated - with the same technical replicate shown twice. This error will be remedied in the published version.

    1. On 2022-05-29 22:25:18, user Andres Betancourt-Torres wrote:

      Summary:

      This work investigates the role of nerve growth factor (NGF) during bone repair. Previous work from these authors established that NGF is important for the reinnervation of injured bone tissue. Here, they explore a secondary effect of NGF on mesenchymal cell migration that appears to be mediated by NGF’s low-affinity receptor p75. Using a variety of genetic techniques, the authors demonstrate that NGF promotes stromal cell migration in vitro, and that knockout of p75 in vivo slows bone repair. Further, p75 appears to control the expression of genes associated with cell migration. Thus, in addition to its role in bone reinnervation, NGF may act via p75 to promote stromal cell migration during bone repair.

      Major successes:

      The major success of the paper is a clear and well established connection between p75-NGF signaling and an effect on mesenchymal cell migration in mice. Also established is the importance of p75 for other processes, such as NGF production in macrophages and ossification of stromal cells.

      Major Weaknesses:

      The authors do not establish whether the effects of p75 knockout are independent of other NGF signaling pathways, such as the Trk family of NGF receptors. Thus, it is difficult to determine the relative importance of p75 versus Trk signaling in many of their experiments.

      Impact: This paper is the first to describe the dependence of calvarial bone repair on p75 signaling. This finding could have important clinical implications for treating bone injuries.

      Major Points:

      -A description of review committees overseeing the use of human samples for the research presented in this paper should be included.

      -Much of the paper relies on understanding the genetic tools, particularly transgenic mouse lines. There is no explanation in the text of what many of these transgenic lines are or what the abbreviations/notation used for them mean (e.g. NgfLysM). Interpretation of the results would be made easier if the authors included one-sentence descriptions of each of these tools and the logic behind using them. The genetics should also be added to the figures when they are critical to the experiment (e.g. a diagram of how the Cre-ER system works in figure 2).

      -In other contexts, p75 plays a modulatory role in neurotrophin signaling through its influence on other receptor pathways (e.g. Trks). The authors did not test here whether the effects of p75 knockout were via independent functional consequences of the p75 pathway, or relied on modulatory influences over other neurotrophin receptor pathways. For example, the results shown in figure 1 could be largely the result of TrkA signaling, with only partial dependence on p75. The additional finding that p75 knockout reduces overall NGF expression by macrophages (Fig 5) also further complicates the interpretation of many of the in vivo results. To address these complications, the authors could test whether p75 deletion from stromal cells influences the function of other neurotrophin receptors. This can be accomplished by using Trk inhibitors in conjunction with the p75 knockout/knockdown (these authors have demonstrated the ability to use such tools in their previous paper). This is an important experiment because it would determine whether the influence of NGF on p75 can be studied independently of its role in promoting reinnervation via Trk signaling, or if the two phenomena are better examined in relation to each other.

      -The authors’ should acknowledge additional caveats of their data from human cells/tissue. An important role for p75 in human cell migration is demonstrated in vitro, but it is not fully established in vivo. The observation that p75 is expressed during human bone injury does not alone indicate its function in vivo. Further, the human samples used were taken from tibia and ribs, whereas the rest of the paper is focused on calvarial bone repair. The authors should address these caveats and adjust the sentence beginning on line 261 to better reflect the full range of possibilities.

      -The paper emphasizes a role for p75 in cell migration. However, it is also clear that p75 likely influences a range of cellular functions beyond cell migration as well. For example, RNA-seq experiments revealed a wide range of genes whose expression changed following p75 knockouts. Functions relating to NGF translation in macrophages were also likely impaired. These findings suggest that p75 may be critical to a broad range of cellular processes during injury repair, rather than just migration. Devoting more text to the discussion of p75’s role beyond just coordinating cell migration may broaden interest in this paper beyond its current scope.

      -The authors should include further details about calvarial defect procedures. Specifically, the authors should elaborate on why they choose this injury model over other available models that could recreate common fractures that skulls experience (e.g. of possible reasons: convenience for observations or less pain for animals). At a minimum, the authors should state a reason why they choose this injury model for their studies. This discussion could best fit in the Materials and Methods.

      Minor Points:

      -The number of observations appears to be underpowered for some experiments. Particularly, the results in Figs. 2K and 4C look to be trending towards significance, but include small sample sizes. A power analysis for these data, or increasing the number of observations per sample for these experiments, would strengthen the authors’ interpretations of the data.

      -The authors state the macrophage populations show a minor shift in population distribution based on the single cell data, but their IF shows significant differences in the number of macrophages at the injury site in the p75fl/fl and p75PDGFRa mice. An explanation for this discrepancy should be included.

      -The data in figure 5 demonstrate that p75 knockout depletes NGF expression in macrophages. This suggests a positive feedback loop between NGF expression and NGF signaling. The authors should explore the consequences of this finding in their discussion as it may be important for considering the interaction between p75 and Trk signaling during bone repair in vivo.

      -The authors should consider testing tissue samples for the presence of osteoclasts, due to the hypothesis that these cells could modulate the activity of osteoblasts. Generating this data would reinforce Figure 2 and the argument that p75 deletion is driving the lack of bone repair.Alternatively, the authors could discuss how osteoclasts modulate the osteoblast activity they describe through the presented data. This topic could be addressed in the Discussion section, for example as either a study limitations or future projections of this project.

      -The authors should consider generating new images for Figure 2 panel I, and see if they can observe osteoblasts in the fracture healing area, using a higher magnification. This could reinforce the comparison among the two conditions presented by demonstrating the presence and hence participation of osteoblasts in the fracture healing process.

      Stylistic Points:

      -The order of the figures is a bit confusing. The authors switch back and forth between in vitro and in vivo experiments. One possible order is: Fig 1, 4, 3, 5, 2, 6.

      -Typo on line 77: “microdissection bone defect site”.

      -Reorganize Figures 1 H and I as Figures 1 B and C; they validate the model, and it may help readers accept the model before reporting any further data.

      -Each chart should have its own legend. Although the color coding is clear, this will help each graph to stand independently from each other and help readers interpret the data quickly.

      -Remove “squares” from the test in the Materials and Method section, or substitute with any possible missing symbol.

      Whitney Tamaki (Whitney.Tamaki@ucsf.edu)<br /> Scott Harris (Scott.Harris@ucsf.edu)<br /> Andrés Betancourt-Torres (Andres.Betancourt-Torres@ucsf.edu)

    1. On 2022-05-28 14:34:57, user Elizabeth Kellogg wrote:

      Many people have asked us whether this paper has been submitted, so we are adding a follow up comment here. The paper as written includes three sets of data: 1) A four-gene phylogeny with broad taxon sampling, 2) phylogenetic analysis of transcriptomes of a smaller number of taxa, and 3) a plastome phylogeny. The four-gene phylogeny is robust and shows clearly that one subgenome of Zea-Tripsacum is closely related to Urelytrum and Vossia. The plastome phylogeny is also solid but has been superseded by the phylogeny presented by Welker, McKain et al. (Journal of Systematics and Evolution 58: 1003-1030. doi: 10.1111/jse.12691).

      In response to a reviewer, we added some transcriptomes of new taxa to better represent the Ratzeburgiinae. We have discovered an error in the transcriptome analyses after this addition and cannot reproduce that particular set of results. Rather than continue to pursue transcriptomics, we are proceeding to replace those data with full genome sequence of Vossia and re-doing that part of the analysis.

    1. On 2022-05-28 14:29:51, user Gene Warren wrote:

      I didn't see when the sera from patients hospitalized during the delta wave was collected. I'm guessing it was during their hospitalization, but I'm not sure, and if it was instead collected during the study period I'm curious what the time elapsed since their hospitalization was.

    1. On 2022-05-24 13:52:55, user Gustavo J. Gutierrez wrote:

      Interesting story and conceptually powerful to see that co-opting an E2 may also work to induce degradation of a target by the UPS. Just a small remark, E2s are not ubiquitin ligases, unless I missed something in recent years regarding the nomenclature. E2s are ubiquitin conjugating enzymes or ubiquitin-carrier enzymes.

    1. On 2022-05-24 09:13:50, user NATTASIT PRAPHAWI wrote:

      Hi! Your work is interesting.<br /> YAP seems to regulate the patterning of gastruloid.<br /> I wonder that YAP nuclear localization is differentially express through out the hESC colonies?

    1. On 2022-05-23 03:35:17, user Mutaz M. Jaber wrote:

      Interesting work. Have you considered the effect of clinical perturbations (sampling time, dosing time, ... etc) with PAM algorithm?

    1. On 2022-05-20 03:55:55, user Jake Gratten wrote:

      Response to Morton et al. (2022): model mis-specification criticism overlooks sensitivity analyses and orthogonal analyses

      The core criticism of our study (Yap et al., 2021) made by Morton et al. was that the linear mixed model (LMM) framework we employed includes a questionable biological assumption – that diet and the microbiome are independent. They correctly note that diet is known to influence the microbiome (David et al., 2014; Rothschild et al., 2018), and thus, as these factors are inter-related, our model may be prone to biased inference. We acknowledge these points in relation to the specific LMM (see below) on which the critique by Morton et al. is focused. However, we respectfully disagree with their conclusion that this issue invalidates the findings reported in our paper, because their critique (1) incorrectly asserts that this result formed the basis of our conclusions, and (2) it overlooks several key analyses, including extensive sensitivity analyses that were specifically performed to test this (and other) assumptions.

      Morton and colleagues focus on a single LMM analysis of ASD in their critique, in which we adjusted for sex, age and diet, the latter by fitting the top three principal components from PCA of the centre log ratio (clr)-transformed percent energy variables from the Australian Eating Survey (AES), a validated food frequency questionnaire. In this analysis, we found that 0% of the variance in ASD diagnosis was associated with the microbiome, irrespective of the microbiome features used to construct the correlation matrix describing the relationships between random effects (e.g., common species, rare species, common genes, rare genes) (Yap et al., 2021). As diet is correlated with the microbiome, it is possible that adjusting for diet in this analysis has removed variance in ASD diagnosis that may be attributable to the microbiome. In their critique, the authors present simulations purporting to show that this issue could lead to failure to detect even very large proportions of variance (in their example 83%) (Morton, Donovan, & Taroncher-Oldenburg, 2022).

      Unfortunately, they fail to mention that we also performed a LMM analysis of ASD in which we did not adjust for diet (or sex or age). If there was an effect of the microbiome on ASD that had previously been removed by adjusting for diet, then this should now be “revealed” (i.e., captured by the microbiome random effect). However, we found precisely the same result as in our original analysis: that is, 0% of the variance in ASD diagnosis is associated with the microbiome (Yap et al., 2021). Based upon this analysis of the available data we believe it is unlikely that our conclusions have been biased by model mis-specification.

      The authors also do not acknowledge that we performed LMM analyses of traits other than ASD, and whereas there was negligible signal for ASD, IQ and sleep problems, we found large and significant associations of the microbiome with age, sex and stool consistency. Our results for age (i.e., ~30% of the variance associated with common microbiome species) are particularly notable because they recapitulate the findings reported in a large (independent) sample of >30K adult stool metagenomes (Rothschild et al., 2020). Our LMM results for age, sex and stool consistency were also largely unaffected by adjusting for diet (Yap et al., 2021). These analyses, which were specifically included for the purpose of benchmarking the findings for ASD, provide further evidence that our methods are not prone to under-estimating the proportion of trait variance associated with the microbiome.

      It is also relevant to highlight that the directionality of the causal graphs presented by Morton et al. in Figure 1 of their article (i.e., a causal effect of both the microbiome and diet on the host phenotype) are problematic, since the variance component estimates from these models might reflect cause or consequence of the focal trait. This is because microbiome taxonomic proportions change, unlike genotypes used in analogous LMM methods for estimating heritability (which are present at birth and therefore representative of causality). To demonstrate this, take as an example our analysis in which age was the dependent variable and microbiome measures were fitted as random effects (allowing capture of their interdependence). We find roughly 30% of the variance in age is associated with common microbiome species. Clearly, the way to interpret this result is that age is causal for the variance in the microbiome, not the other way round. It is equally possible that ASD influences diet and in turn the microbiome, as opposed to the opposite view espoused by Morton et al. Indeed, the wording used in their critique (i.e., “A more accurate model would have assumed an architecture that explicitly incorporates the direct influence of diet on the ASD phenotype as well as an indirect influence of diet on the ASD phenotype via the microbiome”) appears not to recognise this possibility.

      Looking beyond the LMM analyses in our paper, Morton and colleagues also did not consider several other key sets of analyses on which are conclusions are based, including differential abundance testing using ANCOM (Analysis of Composition of Microbiomes) and extensive linear model analyses. In our ANCOM analysis of ASD, we find a single robustly associated species (Romboutsia timonensis) when adjusting for sex, age and dietary PCs, but this same species remains the only significant finding in analyses without covariates (Yap et al., 2021). This is entirely consistent with our LMM model findings but is not what would be expected if the microbiome was associated with a high proportion of variance in ASD diagnosis. Indeed, irrespective of how the data are analysed (e.g., sibling pairs only, excluding siblings, excluding children with recent exposure to antibiotics, and others), we find negligible evidence for association of individual species with ASD (other than R. timonensis), and no support whatsoever for taxa previously reported to be associated with ASD.

      In our linear model analyses, we show that quantitative measures of the autism spectrum, including both psychometric measures (e.g., ADOS-2/G Restricted and Repetitive Behaviour (RRB) calibrated severity scores) and polygenic scores were associated with reduced dietary diversity (Yap et al., 2021). The most parsimonious interpretation of these findings is that RRBs, which are one of the core diagnostic signs of ASD, manifest in the form of more selective dietary preferences. Polygenic scores, as an immutable component of propensity to ASD-associated traits, are an important and novel aspect of our analysis, given they facilitate preliminary causal inference (noting that we were careful to avoid strong statements about causality in our paper). In contrast, other cross-sectional autism microbiome studies – whose results have been prioritised by Morton et al. – have not exploited genetic predictors for autism-related traits and so cannot distinguish between cause and consequence.

      Overall, using a variety of orthogonal analytical approaches, we find a strong and consistent signal that ASD (and autistic traits) is associated with reduced dietary diversity, and that diet in turn is associated with the microbiome (Yap et al., 2021). These results are consistent with existing evidence for dietary effects on the microbiome (David et al., 2014; Rothschild et al., 2018) – as pointed out by Morton et al. – and with prior evidence (backed by clinical and lived experience) for an association of autism with diet (Berding & Donovan, 2018). We find no direct association of ASD with the microbiome, a result to which Morton and colleagues express surprise, their argument being that if ASD is associated with diet and diet influences the microbiome, then how can there be no direct ASD-microbiome association? The answer is simply that we have a finite sample, and the effect sizes are subtle. We expect that in a larger sample we might observe a direct association, but also stronger evidence that this is due to changes in diet that are related to autistic traits. This is a considerably more intuitive and parsimonious explanation for associations of the microbiome with ASD than the idea that the microbiome contributes to autistic traits, not least because there is strong evidence that ASD is a neuro-developmental condition, and expression of established ASD genes is enriched prenatally (Satterstrom et al., 2020). In this context, it is worth emphasising that the high estimated heritability of ASD (70-80%) (Bai et al., 2019) leaves relatively little room for other putative etiological causal factors (e.g., maternal immune activation). This is especially true given de novo mutations that are known to be important in ASD (Sanders et al., 2015; Sanders et al., 2012; Satterstrom et al., 2020) largely do not contribute to heritability estimates (i.e., because they are not shared by relatives) and so must consume an additional proportion of the remaining 20-30% of variance.

      Morton et al.’s criticism of our study comes despite it being the largest (and therefore most statistically well-powered) to date. Our study also has the dual benefits of matching data on diet and other confounders, which are lacking in many prior studies, and deep metagenomic sequencing, compared to inferior 16S technology in most published ASD microbiome papers. We note that ours is not the first study to report negligible association of the microbiome with ASD (Gondalia et al., 2012; Son et al., 2015). We also point to a recent review in Cell on microbiome studies in animal models (including for autism) highlighting the implausibility of the high proportion of positive findings, asserting that the field suffers from publication bias (Walter, Armet, Finlay, & Shanahan, 2020). That said, we acknowledge that our study has limitations, reflecting difficulties of collecting idealised data sets. Prospective studies collecting faecal samples from infants prior to autism diagnosis are needed to further advance the field, but these are challenging both logistically and because sample size is limited by the population prevalence of ASD (~1%).

      To sum up, we thank Morton et al. for their comments in relation to one specific analysis in our paper. This provides us with the opportunity to clarify the detailed analyses that we performed to reach our conclusions. Unfortunately, the critique from Morton et al. (based solely on simulations) overlooks most of our results, including sensitivity analyses that directly address their criticism. The authors suggest that our data should be re-analysed. We note that our data are available by application to the Australian Autism Biobank which allows other researchers to provide objective empirical evaluation. We are committed to transparent research and provide extensive supplementary materials and publicly available code and hope others in the research community will build upon our work.

      Chloe X. Yap, Peter M. Visscher, Naomi R. Wray and Jacob Gratten <br /> (On behalf of all authors)

      References<br /> Bai, D., Yip, B. H. K., Windham, G. C., Sourander, A., Francis, R., Yoffe, R., . . . Sandin, S. (2019). Association of Genetic and Environmental Factors With Autism in a 5-Country Cohort. JAMA Psychiatry, 76(10), 1035-1043. doi:10.1001/jamapsychiatry.2019.1411

      Berding, K., & Donovan, S. M. (2018). Diet Can Impact Microbiota Composition in Children With Autism Spectrum Disorder. Front Neurosci, 12, 515. doi:10.3389/fnins.2018.00515

      David, L. A., Maurice, C. F., Carmody, R. N., Gootenberg, D. B., Button, J. E., Wolfe, B. E., . . . Turnbaugh, P. J. (2014). Diet rapidly and reproducibly alters the human gut microbiome. Nature, 505(7484), 559-563. doi:10.1038/nature12820

      Gondalia, S. V., Palombo, E. A., Knowles, S. R., Cox, S. B., Meyer, D., & Austin, D. W. (2012). Molecular characterisation of gastrointestinal microbiota of children with autism (with and without gastrointestinal dysfunction) and their neurotypical siblings. Autism Res, 5(6), 419-427. doi:10.1002/aur.1253

      Morton, J. T., Donovan, S. M., & Taroncher-Oldenburg, G. (2022). Decoupling diet from microbiome dynamics results in model mis-specification that implicitly annuls potential associations between the microbiome and disease phenotypes—ruling out any role of the microbiome in autism (Yap et al. 2021) likely a premature conclusion. biorxiv. doi:https://doi.org/10.1101/202...

      Rothschild, D., Leviatan, S., Hanemann, A., Cohen, Y., Weissbrod, O., & Segal, E. (2020). An atlas of robust microbiome associations with phenotypic traits based on large-scale cohorts from two continents. biorxiv. doi:https://doi.org/10.1101/202...

      Rothschild, D., Weissbrod, O., Barkan, E., Kurilshikov, A., Korem, T., Zeevi, D., . . . Segal, E. (2018). Environment dominates over host genetics in shaping human gut microbiota. Nature, 555(7695), 210-215. doi:10.1038/nature25973

      Sanders, S. J., He, X., Willsey, A. J., Ercan-Sencicek, A. G., Samocha, K. E., Cicek, A. E., . . . State, M. W. (2015). Insights into Autism Spectrum Disorder Genomic Architecture and Biology from 71 Risk Loci. Neuron, 87(6), 1215-1233. doi:10.1016/j.neuron.2015.09.016

      Sanders, S. J., Murtha, M. T., Gupta, A. R., Murdoch, J. D., Raubeson, M. J., Willsey, A. J., . . . State, M. W. (2012). De novo mutations revealed by whole-exome sequencing are strongly associated with autism. Nature, 485(7397), 237-241. doi:10.1038/nature10945

      Satterstrom, F. K., Kosmicki, J. A., Wang, J., Breen, M. S., De Rubeis, S., An, J. Y., . . . Buxbaum, J. D. (2020). Large-Scale Exome Sequencing Study Implicates Both Developmental and Functional Changes in the Neurobiology of Autism. Cell, 180(3), 568-584 e523. doi:10.1016/j.cell.2019.12.036

      Son, J. S., Zheng, L. J., Rowehl, L. M., Tian, X., Zhang, Y., Zhu, W., . . . Li, E. (2015). Comparison of Fecal Microbiota in Children with Autism Spectrum Disorders and Neurotypical Siblings in the Simons Simplex Collection. PLoS ONE, 10(10), e0137725. doi:10.1371/journal.pone.0137725

      Walter, J., Armet, A. M., Finlay, B. B., & Shanahan, F. (2020). Establishing or Exaggerating Causality for the Gut Microbiome: Lessons from Human Microbiota-Associated Rodents. Cell, 180(2), 221-232. doi:10.1016/j.cell.2019.12.025

      Yap, C. X., Henders, A. K., Alvares, G. A., Wood, D. L. A., Krause, L., Tyson, G. W., . . . Gratten, J. (2021). Autism-related dietary preferences mediate autism-gut microbiome associations. Cell, 184(24), 5916-5931 e5917. doi:10.1016/j.cell.2021.10.015

    1. On 2022-05-19 12:09:27, user Karel Morawetz wrote:

      Visualization of TT virus particles recovered from the sera and feces of infected humans.<br /> Y. Itoh, M. Takahashi, +6 authors H. Okamoto, Published 20 December 2000, BiologyBiochemical and biophysical research communications

      TT virus (TTV) has not yet been cultured or visualized. We attempted to recover and visualize TTV-associated particles from the serum samples and feces of infected humans. Serum samples were obtained from 7 human immunodeficiency virus (HIV)-infected patients. Three patients had a high TTV DNA titer (10(8) copies/ml), three had a low TTV DNA titer (10(2) copies/ml), and one was negative for TTV DNA. Fecal supernatant was obtained from a different TTV-infected subject. The serum samples were fractionated by high-performance liquid chromatography, and TTV DNA-rich fractions were subjected to floatation ultracentrifugation in cesium chloride. Virus-like particles, 30-32 nm in diameter, were found in the 1.31-1.33 g/cm(3) fractions from each of the three serum samples with high TTV DNA titer, but not in any fraction from the four serum samples that either were negative for TTV DNA or had low TTV DNA titer. The TTV particles formed aggregates of various sizes, and immunogold electron microscopy showed that they were bound to human immunoglobulin G. Similar virus-like particles with a diameter of 30-32 nm banding at 1.34-1.35 g/cm(3) were visualized in fecal supernatant with TTV genotype 1a by immune electron microscopy using human plasma containing TTV genotype 1a-specific antibody.

    1. On 2022-05-18 20:16:06, user Yosuke Tanigawa wrote:

      Hi Andrew,

      Congrats on the beautiful work and the talk at #BoG22. I enjoyed the flexible modeling framework in the two-step GP, enabling multiple responses (potentially modeled with low-rank structures). For the multi-output GP, one naive approach might be running PCA/SVD on the output matrix Y (on one of the original coordinates, perhaps with the most number of spots) to capture the most variation. I wonder if you had tried something simple like this before establishing your approach (k-NN-based response filtering combined with linear modeling with LMC) and have some insights around this topic. Thanks!

      Best,<br /> Yosuke